Detailed information on CNT3035490


BLAST search results

BLAST vs Swiss-Prot:
sp|Q39613|CYPH_CATRO, E-value = 2e-90

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30517653Cucumis meloJuglans regia60.5715.5781.54298forward
CNT30702610Cucumis meloQuercus lobata28.0526.4486.96138forward
CNT3019668Cucumis meloCitrullus lanatus19.3122.4192.6395forward
CNT3071229Cucumis meloQuercus suber43.0928.7385.38212forward
CNT30632225Cucumis meloVigna unguiculata60.3761.2484.18297forward
CNT30198931Cucumis meloPisum sativum39.2356.9382.38193forward
CNT30507180Cucumis meloNicotiana attenuata45.5333.0482.14224forward
CNT3043301Cucumis meloPrunus dulcis61.3842.3684.11302forward
CNT30167187Cucumis meloPistacia vera82.7259.8581.33407forward
CNT30638631Cucumis meloCapsicum annuum57.1137.2782.56281forward
CNT3090362Cucumis meloSolanum tuberosum25.4126.2184.8125forward
CNT30303130Cucumis meloTriticum aestivum37.857.7679.03186forward
CNT30569495Cucumis meloActinidia chinensis46.9540.8184.42231forward
CNT3084160Cucumis meloVigna radiata61.3835.1684.44302forward
CNT30145071Cucumis meloMedicago truncatula37.239.3584.7183forward
CNT30240409Cucumis meloAvena sativa57.1138.8781.85281forward
CNT30667711Cucumis meloTriticum dicoccoides40.8529.6579.1201forward
CNT30312502Cucumis meloCamelina sativa26.0236.1682.03128forward
CNT30140197Cucumis meloLolium perenne57.7235.5479.23284forward
CNT30653963Cucumis meloRosa chinensis60.3735.785.52297forward
CNT30128639Cucumis meloCorymbia citriodora2524.9582.93123forward
CNT30624974Cucumis meloDaucus carota82.7255.9183.05407forward
CNT30155236Cucumis meloPrunus persica77.6443.0283.25382forward
CNT30430128Cucumis meloPapaver somniferum46.1427.8284.14227forward
CNT30706413Cucumis meloPrunus avium26.2239.0988.37129forward
CNT3022997Cucumis meloPopulus trichocarpa26.0224.2486.72128forward
CNT30175854Cucumis meloVigna angularis41.8761.6884.95206forward
CNT30724737Cucumis meloLupinus angustifolius45.7333.2889.33225forward

Expression of CNT3035490

Peptides detected in this lncRNA

>peptide 1 (38 aa)
PVSRSFQSSNPLSRRLLPHPYPRRLDRTQRASHRANQS*

>peptide 2 (68 aa)
RFRGPSRARTHFLDGFYHIHTLDDLTEHNVLPIEPISLSGANEELRSVGSRSGVLLDEVLIGELGSVD*

>peptide 3 (64 aa)
MKGFAASADSLLTSAECTKVLGGARSDIGVELHHDPAGRCAADRHVEENFRVWHFWIVSLSSEIS

>peptide 4 (31 aa)
MTILCNEGVCRFCRLPSHQCRVHESSRRCEE*

Sequence

>CNT3035490
CCGGTTTCGAGGTCCTTCCAGAGCTCGAACCCACTTTCTCGACGGCTTTTACCACATCCATACCCTCGACGACTTGACCGAACACAACGTGCTTCCCATC
GAGCCAATCAGTCTTAGCGGTGCAAATGAAGAACTGAGATCCGTTGGTTCCAGGTCCGGTGTGCTTCTTGATGAAGTTCTCATCGGCGAACTTGGCTCCG
TAGATTGACTCACCTCCAGTACCATTTCCGGCGGTGAAATCGCCTCCCTGGCACATGAAATTAGGGATCACACGGTGGAATGACGATCCTTTGTAATGAA
GGGGTTTGCCGCTTCTGCCGACTCCCTTCTCACCAGTGCAGAGTGCACGAAAGTTCTCGGCGGTGCGAGGAGTGACATCGGCGTAGAGCTCCATCACGAT
CCGGCCGGCCGGTGCGCCGCCGATAGACATGTCGAAGAAAACTTTAGGGTTTGGCATTTTTGGATTGTTTCTCTGAGTTCCGAAATCTCTTA