CANTATAdb - search

Detailed information on CNT30351849

BLAST search results

BLAST vs Swiss-Prot:
sp|Q3ZJ46|PSBD_TUPAK, E-value = 1e-17

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)

Target	Query species	Target species	Query coverage (%)	Target coverage (%)	Identity	Alignment length (nt)	Orientation
CNT30678334	Eragrostis tef	Setaria viridis	36.18	14.8	95.83	144	reverse complement
CNT3021516	Eragrostis tef	Citrullus lanatus	36.18	7.83	93.06	144	reverse complement
CNT30730546	Eragrostis tef	Corchorus capsularis	21.36	14.38	91.76	85	reverse complement
CNT30406883	Eragrostis tef	Beta vulgaris	13.57	21.01	92.59	54	reverse complement
CNT30524944	Eragrostis tef	Phaseolus vulgaris	36.93	14.76	91.16	147	reverse complement
CNT30201936	Eragrostis tef	Pisum sativum	27.39	12.33	95.41	109	reverse complement
CNT30710142	Eragrostis tef	Glycine max	24.87	22.2	88.89	99	reverse complement
CNT30300194	Eragrostis tef	Triticum aestivum	36.18	6.84	95.83	144	reverse complement
CNT30384312	Eragrostis tef	Triticum turgidum	36.18	3.3	95.83	144	forward
CNT30569656	Eragrostis tef	Actinidia chinensis	21.36	10.1	90.59	85	reverse complement
CNT30543269	Eragrostis tef	Brassica napus	21.36	2.87	91.76	85	reverse complement
CNT30236148	Eragrostis tef	Brassica oleracea	27.39	7.1	92.66	109	reverse complement
CNT30509374	Eragrostis tef	Solanum lycopersicum	16.83	33.5	88.06	67	reverse complement
CNT30555990	Eragrostis tef	Oryza glaberrima	27.39	6.95	96.33	109	reverse complement
CNT30257720	Eragrostis tef	Avena sativa	27.39	14.85	100	109	reverse complement
CNT30664842	Eragrostis tef	Triticum dicoccoides	27.64	16.18	94.55	110	reverse complement
CNT3018229	Eragrostis tef	Zea mays	36.18	64.29	95.83	144	forward
CNT30355468	Eragrostis tef	Lactuca sativa	36.93	12.02	93.2	147	reverse complement
CNT30416238	Eragrostis tef	Papaver somniferum	36.18	18.8	91.67	144	reverse complement
CNT30331679	Eragrostis tef	Dioscorea rotundata	21.36	12.41	88.24	85	reverse complement
CNT30100296	Eragrostis tef	Oryza rufipogon	27.39	24.33	96.33	109	reverse complement
CNT30116821	Eragrostis tef	Oryza nivara	27.39	8.51	95.41	109	reverse complement

Expression of CNT30351849

Peptides detected in this lncRNA

>peptide 1 (36 aa)
DSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGL*

>peptide 2 (49 aa)
IQWLLLTAFGPKSLVLLFPINVGYISLCYLYPSPVYELWIRSPHSFIES*

>peptide 3 (59 aa)
MKFINENEVVNGRVKDFPGVRYRIIRGTLDVVAVKNCQQGHSSALYILIQDLYHLMMPCE

Sequence

>CNT30351849
TGATTCAATGGTTACTGCTAACCGCTTTTGGTCCCAAATCTTTGGTGTTGCTTTTTCCAATAAACGTTGGTTACATTTCTTTATGCTATTTGTACCCGTC
ACCGGTTTATGAATTGTGGATAAGGTCTCCTCACTCTTTCATAGAAAGCTAGAAAGTGAGGAAGTAGGGTTTAGCTAAGAAATAAACAGGGGTAAGGCAT
GGGTAAGGTAGGTATCATATGAAATTCATAAATGAAAATGAAGTAGTTAATGGGAGGGTTAAGGATTTTCCCGGTGTGAGATATCGCATTATTCGAGGAA
CCCTAGATGTTGTCGCAGTAAAGAATTGTCAACAAGGGCATTCTAGTGCGTTGTATATTCTTATTCAAGACTTGTATCATTTGATGATGCCATGTGAA