Detailed information on CNT3035176


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONSTUT001430, E-value = 4e-35

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30523536Cucumis meloSetaria italica69.2767.4380.05381forward
CNT30640872Cucumis meloNymphaea colorata76.1855.3579.71419forward
CNT30536082Cucumis meloEucalyptus grandis94.3687.6777.65519forward
CNT30315993Cucumis meloCorylus avellana73.8240.4883.5406forward
CNT30549166Cucumis meloIpomoea triloba58.7348.0780.5323forward
CNT30516792Cucumis meloJuglans regia82.7351.1282.42455forward
CNT30376525Cucumis meloArabidopsis thaliana69.0949.6782.37380forward
CNT30500604Cucumis meloCoffea canephora76.1868.1379.71419forward
CNT30616482Cucumis meloSesamum indicum78.1828.279.77430forward
CNT30269263Cucumis meloChenopodium quinoa82.3659.4579.69453forward
CNT3021339Cucumis meloCitrullus lanatus96.9184.0790.43533forward
CNT30727661Cucumis meloCorchorus capsularis92.7381.4779.8510forward
CNT30379051Cucumis meloManihot esculenta67.4553.1582.48371forward
CNT30403468Cucumis meloBeta vulgaris54.9139.0279.47302forward
CNT30524942Cucumis meloPhaseolus vulgaris63.0951.7180.98347forward
CNT30628902Cucumis meloVigna unguiculata5062.0879.64275forward
CNT30195835Cucumis meloPisum sativum29.2763.3983.85161forward
CNT30490956Cucumis meloOlea europaea43.0956.4382.7237forward
CNT30710467Cucumis meloGlycine max36.3627.6684200forward
CNT3042435Cucumis meloPrunus dulcis88.1870.0982.06485forward
CNT3091613Cucumis meloSolanum tuberosum65.8247.8880.11362forward
CNT30304911Cucumis meloTriticum aestivum24.3622.4184.33134forward
CNT30559890Cucumis meloActinidia chinensis70.7356.9583.8389forward
CNT30591924Cucumis meloMusa acuminata71.0973.3679.28391forward
CNT3088022Cucumis meloVigna radiata28.1835.8884.52155forward
CNT30234460Cucumis meloBrassica oleracea85.4566.8681.49470forward
CNT30508904Cucumis meloSolanum lycopersicum74.5566.3480410forward
CNT30554721Cucumis meloOryza glaberrima62.1836.5879.82342forward
CNT30145737Cucumis meloMedicago truncatula47.8242.6982.13263forward
CNT30256659Cucumis meloAvena sativa56.9143.7879.23313forward
CNT30311656Cucumis meloCamelina sativa60.3659.8281.63332forward
CNT3062262Cucumis meloArabidopsis lyrata68.5568.881.96377forward
CNT3076593Cucumis meloBrassica juncea61.4561.982.54338forward
CNT30263459Cucumis meloBrassica rapa63.6464.783.14350forward
CNT30607743Cucumis meloGossypium raimondii99.0980.7479.82545forward
CNT30216750Cucumis meloKalanchoe fedtschenkoi55.4562.2480.66305forward
CNT3067979Cucumis meloLeersia perrieri56.7386.6780.13312forward
CNT30205386Cucumis meloHelianthus annuus71.8255.2479.49395forward
CNT30625810Cucumis meloDaucus carota54.9144.5482.45302forward
CNT30687691Cucumis meloTriticum urartu44.5527.4481.63245forward
CNT30476941Cucumis meloArabidopsis halleri85.4558.6880.43470forward
CNT30596736Cucumis meloOryza meridionalis46.7334.0480.93257forward
CNT30354836Cucumis meloLactuca sativa55.4552.8681.64305forward
CNT30370935Cucumis meloOryza glumipatula43.4524.6980.75239forward
CNT30154742Cucumis meloPrunus persica99.0964.9681.1545forward
CNT30408809Cucumis meloPapaver somniferum72.3646.0680.4398forward
CNT30573870Cucumis meloVitis vinifera87.2768.0981.88480forward
CNT30705862Cucumis meloPrunus avium75.0938.8982.08413forward
CNT30642027Cucumis meloCannabis sativa56.5548.7582.64311forward
CNT3027877Cucumis meloTheobroma cacao70.1897.7280.57386forward
CNT3051702Cucumis meloAmborella trichopoda81.6473.3778.4449forward
CNT30121049Cucumis meloCitrus clementina82.1841.7780.75452forward
CNT30103004Cucumis meloOryza rufipogon64.3635.5179.38354forward
CNT30498009Cucumis meloDigitaria exilis70.7339.7378.66389forward
CNT30176441Cucumis meloVigna angularis3229.0982.95176forward
CNT30558075Cucumis meloPanicum hallii54.3637.983.28299forward
CNT30551544Cucumis meloOryza brachyantha68.1853.9680375forward
CNT30335475Cucumis meloCynara cardunculus82.7335.0378.9455forward
CNT3049385Cucumis meloCucumis sativus80.5555.9392.33443forward

Expression of CNT3035176

Peptides detected in this lncRNA

>peptide 1 (71 aa)
MLERWGCTKVMWDCKTEMLGCRREMLGCRRVKLGCRRGKLGCRRGKWDCKQVKLDCKQEKWGCSLGKWGCN*

Sequence

>CNT3035176
CTGTAATTGGGCGAGGTTGGGCTATATGGACTTGAAGGAGACAACCGTGGACTACTGGGTGAGTATGCCTGCGATGGGCTGTATTTAGCTGATTGAGGAT
TATAACTAGGTGAGGTTGGACTATAGCTAGGAGAAGTGGGGCTATAGCTTGGAGACGTGGGACTATAGCCAGGGGAGGTGGGGCTATATGCTGGAGAGGT
GGGGCTGTACGAAGGTGATGTGGGACTGTAAGACGGAGATGTTGGGCTGTAGGAGGGAGATGTTGGGCTGTAGGAGGGTGAAGTTGGGCTGTAGGAGGGG
GAAGTTGGGCTGTAGGAGGGGGAAGTGGGACTGTAAGCAGGTGAAGTTGGACTGTAAGCAGGAGAAGTGGGGCTGTAGCTTGGGGAAGTGGGGCTGTAAC
TAGGAGAGGTGGGGCTGTAACTTGGAGAGGTTGGGCTGTAACTGGGAGAGGTGGGTGAATAAGATGGACTTGTAGGAGAATATGCAGGACTAGTTGGGCT
ATAGCCCGGCGAACTAGGACTGTATGTTGGAGATGTTGGACTGTATCCCG