Detailed information on CNT3035167


BLAST search results

BLAST vs Swiss-Prot:
sp|Q03227|COX3_VICFA, E-value = 6e-125

BLAST vs NONCODE:
NONCQUT006840, E-value = 9e-153

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3035167

Peptides detected in this lncRNA

>peptide 1 (72 aa)
MNMDINKSFGRVKLFEIQKSHEISCTPSNFKDKDHTNSLRLANSFRLSFLVELLRTAPWESQLLTAPFLSPS*

>peptide 2 (40 aa)
MNKDSFHKAKGLISNIFRSATKEIHIKNNLRTTPSSKKVD*

>peptide 3 (40 aa)
MNKDSFHKAKGLISNIFRSATKEIHIKNNLRTTPSSKKVD*

>peptide 4 (52 aa)
MNKDSIKKKVKATECWSRPLVPNLAPLIFRSFIYYSLIDLSCNAFYYLIWRN*

>peptide 5 (51 aa)
MKLRRLSRSSLIFFFPLRLLPYFLDYLLKYPIILLLSSSLLSVDSRTRESL*

>peptide 6 (39 aa)
MIEVNWTLVYPQVNMSLSMRRSKNIEKRLNRSAGAVRRL*

>peptide 7 (38 aa)
MELKLTELSFHSSFIFFLWYGFFRGVGLSLVGLEAQRI*

>peptide 8 (37 aa)
MGSLELPLTAFLFLSLFLTLPLRFLSLSFLLFLPFLN*

>peptide 9 (37 aa)
MDINKSFGRVQRILNGILAFFSQCRCIKDGRGPKVMK*

>peptide 10 (34 aa)
MVWILPRSGAFSSRSGGSKNLSEKAPVRKNGESL*

>peptide 11 (35 aa)
MLPWPCRTWISIISFLQAIPHPGLEEVLYEDFEIK*

>peptide 12 (29 aa)
MIRTFANSLRLTFVSFQSSYFITGGRTLD*

>peptide 13 (31 aa)
MFFPRCETSWFRSLRILLIPSTPSPSLHMGI*

>peptide 14 (29 aa)
MKLVALLQISRIRTTQILCASQILSASPS*

Sequence

>CNT3035167
GCCAGTTGCTAAGAAAAAGGTAGAACCATAAATACTATCCGAAATAGTGAAGGGTGCTTGATAATATTCCATTCCTTGAAAGCCTGTGAATACTAGAGCC
AATGAAACGATAGCTACTAAAGCGTAAACATATCGTTTTTCCTTCCCCGCGAGTATAGCATGATGAGCCCAAGTTACAGCTGCTCCGGATGAAAGGAGAA
TAAGGGTATTAAGAAAAGGGATTTCCCGAGGATCTAAAACCCCAATCCCTTTTGGGGGCCAAATACCTCCGATCTCTACCGTAGGTGCCAAAGAAGAATG
AGAAGAAGCCCGAAAAAAAGCAAAAAGGAACATAACCTCCGATACGATAAAGAGAAGAAAACCATATCGAAGTCCTAATTGTACGACTTTGGTATGATGT
CCTTCCAACGTGGATTCACGTAGAACATCGCGCCACCATACGAACATGGTATATAGGAGAAATATGAGGCCCAAACTGAGAAGTCTTGCACCCCCTTGAA
ATGAGTGCATGTACATCACACCTCCTACGGTGGTTGCCAAAGCTCCGAGTGAACCCGAAATAGGCCATGGACTTGGATCTACCAAATGATAAGAATGCCT
CTGAGATTCAATCATAAACCACTTTGCCTCGGTTGTATGTAAACCCCCCCTTCACCCCCACCCGCTAAAGTGGTAAAGAAGGGCTCTTTGGGGTCTCATT
TTCTTTCTATCTGACAGGACTCAAAAATAGGAAGGGATGGTTCTTTCATTGCATTGATAGAAGTCTAACTAGAAAAAGATCTCGTTGCTTTGACCGAGCC
AAGGCATCCTTAATCTTGAAAGCCTTTCTTATGACTGATTTATGGCGTAGAAGGCTTTTAGTGGTCTCATTGAGAATAAAGTCAAAGACTTTGCGAACTC
TTAGATGAAACTACGGAGGCTGAGTAGGAGCAGTCTGATCTTCTTCTTCCCGCTCCGTCTTCTTCCATATTTTCTTGATTATCTACTCAAATATCCGATT
ATTCTACTATTATCATCAAGCCTACTTTCAGTGGATAGTCGGACTCGGGAAAGCCTATAATATAAGAAGAAGACAAGTCCCCACGTCTTTGATTTGAGTC
GCTCCGCTTCGCGCCTTCGGAGGCGTAGTGCTTTCTTTATTGGGCTTTATAGTAATCCTTCAGTTTCTTCTTGGCATCAAAATAGATCAATGAAAGAGGA
AAAAAGAATTTGAGAAAAGAGAAAGCCTATGATTATACTAAAGAGAAAGCCTATGATTATACTGACGGCTTTCCTTCCCAACAAATCTTCGTTCTTAGTT
ATTTGATTCCACTTTCAAACTGAATATATATTCCAGGTTTCCTTGTTCATTGAGGCGGTGCAACCGTCTCTTTCTTTATGTCAAATTCTCCTCGCATATT
TCATTGCGCCTCTATCTTCATTGGTTCTACGTAGCTTAATTAGTCCGAAGGCTCGACTGAAAGGAGTCCAAGATTCAAGCTGAAAGGTGCGAAGGTACTC
GTAGTTTTAGATATAGGGAAGGCGCAAAGAATTTGCGAAAGAGAGAGAAGAAAGATGAGATTTTTTTGAACTTTCTGGGAGTCTTCTGCCTTGCGGAGTA
GGTTCAGGAGAACCCGCTAAAGAAGCAGAGCGGAGGCATCCAAATTCAATTCCTCTTCCTTTAAGCCCTAATTCATTAATATGGATTTCTCAAATTCTTT
GAGCCTTTGAATAATAATGATAAGGACTTTCGCAAATTCTTTGCGCCTAACCTTTGTATCCTTTCAGTCGAGTTATTTCATAACCGGAGGACGGACCCTT
GATTGAATATTTCAGAAATCCATATGAATCTGAAAGGTGCGAAGCAGCTCGACTAAGAAGGAGAGGTGAGAATGAGAAGCCCTCAAGAAAAAAGAAAGAC
TTATCCCTGAAAAGGAGTGCAACGAAGTGAATAAAGGGTGAAAAGAATATTGAAGAACAAGGGGTCATGAAATTCAACAAAAGGATATATGGAATAGTCC
TCCGGACCCGTCTCATTGATAAGGGCTAAGTCAAAGATGGAACTAGAAGAATATTGAGAATTTGAGGCTCGACTGAAAGGAGAGGGGGGGAGAGGGGGGG
TTCAAAGAGAGAAGCGACTGATCGATGTTGTTGTCAGATTCCTTTCATCTTTAGATATTATGTCCACTTAAATGTTGTTGGATAGGCTTTCCCTTTATGG
AACTGAAACTGACTGAACTTTCCTTTCATTCTTCCTTTATCTTTTTTTTATGGTATGGATTCTTCCGCGGAGTGGGGCTTTCTCTAGTAGGTCTGGAGGC
TCAAAGAATTTGAGTGAGAAGGCTCCGGTAAGAAAAAATGGGGAGTCCTTATGAAACTTATCCGGAAACTTCTAACTTCAAACCTTGAATATTCAACCTT
GAAAAGAAGGTAAAGGAGGGAGCGGACTACGGAGGCCTTTTAGTGGAATCTTTTCCGAAAAAAGAGGTCCGACCGCTAAGTGGGAATATATAGGATGAAA
GTAGCGGAGCAGTCTTGTCTCCCTGCTTTCCCCGGGTAGTGGTAGTTTCATTCTTCTTCATTTCTTTTCTTCTATCTCCCACTCCGCGGTTGAATATGAA
AGGCAGTCCCACGGAGCGGGATAATCAAGAAGAAAGCTCCGGATAATTAAGCTACGGAGGACCAAAGAATTTGCGAAGAAAAAGATCTTTTTTATCTAAA
AGACGGAGGCAATAAAAAGTTCATATGGTAGATTGAAGAGGACTGAGGGCTCGAAATGAAAGACGTTCGGACGCTCCGTAGGAGTTGAGAAAGAATGATC
GAGGTCAACTGGACCCTTGTTTATCCACAGGTTAATATGTCCTTATCAATGAGACGCTCAAAGAATATTGAGAAGCGACTTAACAGGAGTGCTGGAGCGG
TCCGAAGGTTATGAAATAACGAGACTGAAAGGTGCGAAGGTACTCGTAGTTTGAAATAGAGCGAAGCAGCTCTACGTTTTCAATATAGGTTCAGAGCGAA
GGTACTCGTAGTTTGAAATATAGGTTCAGAGCGGTTAGGCGCAAAGAATTTGTGTGCTCCTTCAATTCTTTTCGAATTCCACTAGACTTGAAAACAAAGG
CTGAATTCAAGCTAATATGGATATAAACAAGTCCTTCGGACGGGTTCAAAGAATATTGAATGGAATATTAGCTTTCTTTTCACAATGTAGATGTATCAAA
GATGGAAGAGGTCCGAAGGTTATGAAATAACGAGACTGAAAGGTGCGAAGCAGCTCGACTAAGAAGGAGTCAATGAACAAGGCTCGACTGAAAGGAGAGA
GAATTTGAGAAAGACTGATCCCTATTCAAAGGCTTGAAGGAGTGCAAGTCAGAACCATTATAGATAGTCCTTCGGACCACAGGTTAATATGGATTTCAGA
CTCCTAAAAAATCAGTCAATGAACAAGGCGCAAAGAATTTGCGAACAAGGGCTCGACTGAAAGGAGAGGCAGAACCTGGACCTTTGTTTTTCCACAGGAC
TTCGGACCACTCAAACTTATGGGGAGCCTTGAACTTCCTTTAACAGCTTTCCTATTCCTTTCACTTTTTCTGACTTTACCGCTCCGTTTTCTTTCATTAT
CTTTTCTTCTTTTTCTTCCATTCCTTAATTAAACTACTTCTACCTCTTCTGTTTTAGTAGGCTCTCTTCTTTTTCAGACGAAGGATTCTCCCGCTCCGTG
GGGTCTTGGACGAGGATTCTCCCAAGAACCTACTTAAAGGAAGAAAGCCTATCCTGAGACTGAATACGAGAAACTGAAAGGAGAAAGCCTATGATTTTCA
GCAAGCATTTTTGTAAAGTAACAATTCTCTTCAGTTTGGTTTCGGAAAACTTGTTGGTCGCGGATTAGTGCGTTCTGCGCCGCCCGGCGGCCACATAGAA
TTGAGAAAAGCCTATGGTTGAGGCAGCATGAATTTATGAAACTTGACACGTGGGAAGGGATGACTCTTTCTATTCAAACCTGTAAACATAGAAGACCGCC
TCAATGAACAAGGGATCATTCACATAGAATAGTTATTCACAACGAGAAAGGCTCAAAGGATTTGAGAAGGAAGAGGCTCCGTAGGAGTTGAGATGAACAA
GGTCTCGACTGAAAGGAGAGAAACTGCACTTATGAGTCTTTCAGTTACCTTTCTGCCTCTTTAAAGAGAGTTCAAGGTTTTCTATTATCGGAAGAAGAAG
AAGAAGAAAATAGAGGCGCAAAGAATTTGCGAATAAAGGCTAAAAAAAGTGAAGACGAGACTGCTCCGTTAGGAGTCTGAAACCGGAGGACTTGTTCATT
CCACTAATATTGTCTCATTGATAAGGGCTAATAGATTTGACGAGGGCTCGTAGATAAATTCAGGTGCGAAGCAGCTCGACTAAGAAGGAGAGGAGAGGCA
TTTCTCTAAGAAAAGAAGAGAAAACGAGTCCTTCGCAAATTCTTTGCGCCTAACGGAGGGAGTGCAACGAAAGAATTCCACTAATATTGTCCTTTTGACC
TCTGAAATATGGAGAAAGAAAAAGCTCCAGATGATCAAAGCATTTGAGAAGAATTTGAGACTCGACTGCTCCGAAGGAGTCTGAAATCCATATTAACCTG
TGGAATATACTCAACTCAAAAGGAGGTTATGAAATAACTCGACTCCCACGGGGCGAAGAAAGTCGACTGATAAGGAGTCAATGAATAAAGACTCATTTCA
TAAAGCGAAAGGACTGATTTCAAATATTTTCAGGAGTGCAACGAAAGAAATCCATATAAAGAATAACCTCCGGACGACTCCCAGTTCGAAGAAAGTCGAC
TAAGAAGGAGTCAATGAAGAAGGGCGTAGCTTATGTAAAGGTTCGACGAAGGAGCCTCAATGAATAAAGACTCAATCAAAAAGAAAGTCAAAGCGACTGA
GTGCTGGAGCCGTCCATTAGTTCCGAACTTGGCTCCGCTCATCTTCCGTAGTTTCATCTATTATTCTCTTATTGATCTCTCTTGTAATGCTTTCTACTAT
TTGATTTGGAGGAATTGAATTTTGATGCTTCCGAACGACCTTGATTAAAAAACGATGCTTCCTTGGCCGTGTAGAACATGGATTAGCATTATTTCATTCC
TACAAGCGATCCCCCATCCAGGATTGGAAGAAGTGCTATATGAGGACTTCGAGATCAAATAGAATATATTTCTTTCGAGACCTCGTGAGCCACTTATTTC
TCCGAAACAAGAGAGAAAAGTGATTTTCCTCCTTTTTCCCAATAAGTCGACGGCCTGACACCATTGGGATACTTCTTTGAAACTAGAGTACATATAGGAT
ACACCGGTGCTAAAACCTTTTCTCAAGATATCTTCCAAACTGTTGGGGTCCTTGCTCCGTATGTTCTTCCCCCGGTGTGAAACCAGTTGGTTCCGTAGTT
TGAGAATTCTACTGATCCCAAGTACTCCATCTCCATCATTGCATATGGGAATATAGAAAGTCAAGAAGAAAAGGCATGACCAGAAGAATTGTGTGAAATA
AGTCAATTTATCCAGTTGAGGCATTCTTTCTTTTTCTCAATCCAATTCCCTCCAGACAGAAATCCTTCCTGTACGAGTAGTGAAGAACTATAGAGAGCAG
TGGTTGGTTGTTGACCAACGGAAAGCATGGGAGAAAGAAAGATGCTGGCAAGGAAGCATCAAAATTCAATGATGAATAGTGGTCTCATTGATAAGGACAT
ATGAACCTGTCCAAAAACAAAGGTCCAGATGAATATGGATATAAACAAGTCCTTCGGACGGGTCAAATTATTTGAGATTCAGAAGTCCCATGAAATTAGT
TGCACTCCTTCAAATTTCAAGGATAAGGACCACACAAATTCTTTGCGCCTCGCAAATTCTTTCCGCCTCTCCTTCTTAGTCGAGCTGCTTCGCACCGCTC
CGTGGGAGTCTCAACTCCTAACCGCTCCTTTTCTTTCTCCTTCTTAGTCGAGCTGCTTCGCACCTTGAAGGTGAATATGGATTTCTGACTCGTCCTACGT
AGCTTAATTAGGCCTATTAAAAGGCGAACTTTCAGTCGCTTCTCTCCTTTCAGTCGAGCCCTCATCTGGACCTTTGTTTTTGGACGGAGGTCCGACCGCT
AAGTGGGAATATGTAGGATGAAAGTAGCGGCATAATAATAGAATATGATCTTCCAAACCTACTAGAAAGTCTCCCACTACGCTAAAGGAATCAAAAACGG
AATAAGAAGAAGAAGTTCAAGGTTTGAATTTCAAGGATAGGATCAAAGAATTTGAGAGGAATCAGAGGGCTCGACTGAAAGGAGAGAAGAAAGAGACAAA
AGAAAAGAGCTCCTTCTACGGTACGGGCTCCGCGGAGTTTTCTTGAATTGGTAGTTTGAAAGAAAGGAAGAAGGCAATTATAAGGCGCAAAGAGCGAATA
TGGATTTCTTTTAGCGCAAATTCTTTGCTCAAGAAAAAGGAGGTTATGAAATAACTCGACTCCCACGGGGCGAAGAAAGTCGACTGATAAGGAGTCAATG
AATAAAGACTCATTTCATAAAGCGAAAGGACTGATTTCAAATATTTTCAGGAGTGCAACGAAAGAAATCCATATAAAGAATAACCTCCGGACGACTCCCA
GTTCGAAGAAAGTCGACTAAGAAGGAGTCAATGAAGAAGGGCGTAGCTTATGTAAAGGTTCGACGAAGGAGCCTCAATGAATAAAGACTCATTGATAAAG
GCGCAAAGAATTTGCGACTGGTCCGGAGTCCGAAGGACTCAGAAATCCATATTAACCTAGGCAAGGAGCAAAGAATTTGCCATTGATAAGGAGCAAAGAA
TTTGCGAAATGGAAAGCGACAGCTTTTATGGAATTTCATGAGTCCTTCGTCTATTAATCGTCGGGCTCCTTCACAGTCGCTTCGCTTCGCGCGTCCTCTT
TAGTTTCATTCTACTCCTCCGGATTTGAGAGTCCTTCGCAAATTCTTTGGTCCTAACCCGCAAATGCTTTGCGCCTCTCCTGTAAGTCGAGCCGCTTTCG
CTCTCATTGATAAGGAGATCAAATCAGTGGAATAAAAAACAAGTCCTATAAAATGGAAAGCCTATTTAGTGGATAAGTCACCTGGACCTTTGAAATTCAA
CCAGTGAGGACTCTGAAATCTACCATATTCACAAGTCCCGCAACAAGAGATTAATATGGTAGAATAAACAAGTTGCACTCCTTCAAGCCTTTGAATAGGG
ATAAGGACTTTCGCTTTCATTCAACTCCTACTCCGCCTCTCCTTACAGTCGAGTCGCTTTCTCTCCTCTCTTTATTCAACTCAACTCCTCGCAACACATG
TTAATTGATTCAGATTCATATGGATTCAATTAAGGGTTCGTCCATAGGTTATGAAATAA