Detailed information on CNT3035129


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT004405, E-value = 8e-138

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3035129

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MCPSRMWNDDESVRQSTWNMDRCGLRRQPTPRP

>peptide 2 (36 aa)
ECYLVDPASSHMLVSKIKPCMCKYELIQTVKLRMAH*

>peptide 3 (62 aa)
MHLLDKRSTRALPIALMIHDNSMVPQSGDKFCPRLNMGERPIANKYRKGKMIRTLKRESNSA*

Sequence

>CNT3035129
GAATGCTACCTGGTTGATCCTGCCAGTAGTCATATGCTTGTCTCAAAGATTAAGCCATGCATGTGTAAGTATGAACTAATTCAGACTGTGAAACTGCGAA
TGGCTCATTAAATCAGTTATAGTTTGTTTGATGGTATTTGCTACTCGGATAACCGTAGTAATTCTAAAGCTAATACGTGCAACAAACCCCGACTTCTGGA
AGGGATGCATTTATTAGATAAAAGGTCGACGCGGGCTCTGCCCATTGCTCTGATGATTCATGATAACTCGATGGTCCCCCAATCGGGCGATAAATTCTGT
CCAAGGCTAAATATGGGCGAGAGACCGATAGCAAACAAGTACCGCAAGGGAAAGATGATAAGGACTTTGAAAAGAGAGTCAAATAGTGCTTGAAATTGTC
GGGAGGGAAGCGGATGGGGACCGGCGATGTGCCCCAGTCGGATGTGGAACGATGATGAGTCGGTCCGCCAATCGACTTGGAACATGGACCGATGCGGATT
GAGACGACAGCCTACGCCCAGGCCTTT