Detailed information on CNT303371


BLAST search results

BLAST vs Swiss-Prot:
sp|P05348|RBS_MAIZE, E-value = 3e-26

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT303371

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MDDAMLDTSAGELLEAKGTIACRRKEMMR*

>peptide 2 (35 aa)
SLHYVRNCRWMMPCWIHQQENCWKQKEPLHAGEKK*

>peptide 3 (36 aa)
MTRWKASGYAAMASCSSLYTCVASVQPNMGSFHMVQ*

>peptide 4 (54 aa)
MQEADDAVEGVRVRGDGLLQLLVHLRGVGAAEHGQLPHGPVAAVVVARGGWRRT*

Sequence

>CNT303371
AGTCGTTGCACTACGTACGTAATTGTAGATGGATGATGCCATGCTGGATACATCAGCAGGAGAATTGTTGGAAGCAAAAGGAACCATTGCATGCAGGAGA
AAAGAAATGATGAGATAAAGGGAAAAAAAAGGAGGGAGAGAGAGAGAGGAACCAATGCAAGAAGCCGATGACGCGGTGGAAGGCGTCCGGGTACGCGGCG
ATGGCCTCCTGCAGCTCCTTGTACACCTGCGTGGCGTCGGTGCAGCCGAACATGGGCAGCTTCCACATGGTCCAGTAGCGGCCGTCGTAGTAGCACGGGG
AGGCTGGCGGCGGACTTGAGACCCTGGAACGGGGCGACGGCGGTTGCCGACGAGGCCATCATCACGGTGGGCGCCATGGCAAGCTGGCTGGCAGGCTGGC
TAGTATGTGTACCAGCTAGTAGTAGTAGTAGATCGAGCTTGCTTGCTTGGGTCGTCCT