Detailed information on CNT30327689


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30390925Asparagus officinalisTriticum turgidum31.1329.4187.580forward
CNT30241618Asparagus officinalisAvena sativa22.9623.4191.5359forward
CNT30575877Asparagus officinalisOryza barthii31.1326.069080forward

Expression of CNT30327689

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MTPRRKKAPAMSMVSFRPSRRVVYEAKKVERRREQLKALVVVLAVVAV*

>peptide 2 (46 aa)
NNEHGEVLSSAVEDDSEEEEGTGDEHGELPPESAGGVRGEEGRATT*

Sequence

>CNT30327689
CAACAATGAGCATGGCGAGGTCCTGAGCAGCGCCGTTGAAGATGACTCCGAGGAGGAAGAAGGCACCGGCGATGAGCATGGTGAGCTTCCGCCCGAGTCG
GCGGGTGGTGTACGAGGCGAAGAAGGTAGAGCGACGACGTGAACAGCTGAAGGCCTTGGTTGTCGTACTTGCAGTAGTTGCTGTCTAGCGCTGGCTCGTG
TTTCCGGCGGTACACTTTAGGGAAGAACTTGAGCAAGAAATCATCCATTGATGTTAC