Detailed information on CNT30326424


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30326424

Peptides detected in this lncRNA

>peptide 1 (44 aa)
MECCQQGVAEPQDEEPLTPPQKETLEKERKKERNNVLSLLSTKG*

>peptide 2 (49 aa)
MKINEPKYHHIRPMVSMSYEPKIREHNGDIIRKFSKFQSITKSTIQIFM*

>peptide 3 (29 aa)
MKRIWRAQREEEGRLSFKRLVIQFYFFTN*

>peptide 4 (30 aa)
MMICLRRSPTTIHPNKHGRHFATLCLELKK*

>peptide 5 (44 aa)
MKLIEHKEDEVEAIDNHFFNHLRNEKENQRFCNSSSNPCFNWVI*

>peptide 6 (89 aa)
MIGVIECKGTLKTLSKSIPHSFKHTKKNEKDMESTERRRGKIKLQKVSDSILFLHQLVMNSCRIKEIPFWPPALILATSSLSCGQGLHR*

>peptide 7 (80 aa)
MNEDVEGVEVTDEVMDKEEEEMNKILNLRREAKILLVTMDEQEEGETLKDTMRGEMKSLNLNAISATNLAIILGNVKPKS*

>peptide 8 (58 aa)
AIRMKAKLGSQGVWNVVNKVLQSLKMKNHLLHLRRRHWRKKERKKEIMCSHYYQPRVR*

>peptide 9 (64 aa)
MFEKITNNNTSKQAWETLRNSVLRVEKVKKVKFQTLRADYESVLKKKSESIQGYVTTILALVKK*

Sequence

>CNT30326424
GGGCCATTAGAATGAAGGCCAAACTTGGTTCACAAGGGGTATGGAATGTTGTCAACAAGGTGTTGCAGAGCCTCAAGATGAAGAACCACTTACTCCACCT
CAGAAGGAGACATTGGAGAAAGAAAGAAAGAAAGAAAGAAATAATGTGCTCTCACTATTATCAACCAAGGGTTAGATGATGATATGTTTGAGAAGATCAC
CAACAACAATACATCCAAACAAGCATGGGAGACACTTCGCAACTCTGTGCTTAGAGTTGAAAAAGTGAAGAAAGTTAAATTTCAAACTCTAAGAGCTGAC
TATGAGTCCGTTCTTAAGAAGAAAAGTGAATCTATCCAGGGTTATGTTACAACAATTTTGGCGCTGGTGAAAAAATGAAAAGACTCAGAGAAAATATGTA
AGATGTTCATGTCGTTGAGAAAATTCTTTGCTCACTTAACACAAAGTTCAATCTTGTAGTGGTAGCAATAGAAGAAGCCAAAGGCTTGGAGGCCATGGTT
GTTGATGAATTAAATAGGTCATTGCGAGTCCATGAGAAGAGGATGAACCGTGGCAAGCAAGAAAAGGTAGGCTAAGCTCTACAAGAAAAAATGAGTTTAA
AGTCTAGAGGAGGTACTTCTTAGAGAGGATATGAATGAGGATGTGGAAGGGGTCGAGGTCACGGACGAGGTCATGGACAAGGAAGAGGAAGAGATGAACA
AAATTCTCAATTTGAGAAGAGAAGCCAAAATTTTGTTGGTGACCATGGATGAGCAAGAGGAAGGGGAAACTCTAAAAGACACGATGAGAGGAGAAATGAA
AAGTCTCAACTTGAATGCTATTTCTGCAACTAATTTGGCCATTATTCTTGGGAATGTCAAACCAAAAAGCTAGAAAAAGACATGAAACTAATTGAGCACA
AAGAAGATGAAGTGGAGGCTATAGATAACCATTTTTTTAATCATTTGAGAAATGAAAAAGAAAATCAAAGATTTTGTAACTCTAGCTCTAACCCATGTTT
CAATTGGGTAATTTAATGTGTTAAACAGGAATAAATATGATAGGAGTTATAGAATGCAAAGGGACTTTGAAAACCCTAAGTAAATCAATCCCTCATAGCT
TCAAGCACACAAAAAAAAATGAAAAGGATATGGAGAGCACAGAGAGAAGAAGAGGGAAGATTAAGCTTCAAAAGGTTAGTGATTCAATTTTATTTCTTCA
CCAATTAGTTATGAATAGTTGTAGAATAAAAGAAATACCTTTTTGGCCACCAGCGTTGATTCTGGCGACCTCCAGCCTTTCCTGTGGGCAAGGGCTTCAC
CGGTGATGGCTATCATGGCCACTAAACCCACTTAGGACTGGTTGGGTTCAATTAGAGAAAGGATCAGACCCAAGGAAGAAGATAAAGGAAAATTTATCTA
AGGCCCCTTAGAGTTTTGAGAATTTGTTTTAAGTCCAGAACCTATGAAAGGATATTTCTACATAAAATCTATTTAATGAAAAGTTTTTCCTTTTGACCCA
CTAATTTAGAAAAGTAGTTGCTAGGCCCAAGTTCTGTTTAAAAAGAATAGAAATAAATTTCAAAAACCCCCCTAGAAACTAAAAATATTAGTTTTATATC
CAAAATAGTTTGAGTATGGAATCTTTAGTTTTTATGCATCTTGTATGATTATAGGTTTGATCGAGGAGTAGGTTCTTAGAGTACGGTTCTCCAAATTGTT
ATCAATTCTCTTGAGGGACAAATGGATGGCATAATGTTCAACCTACAAAGCAAGCTTCCAAGTACGATCAACATGGGAACAAAAATGCAAGAATTAAGAT
GAAAATCAATGAGCCTAAATATCACCACATTAGGCCTATGGTTTCGATGAGTTATGAACCCAAAATTAGGGAGCATAATGGAGATATTATTCGTAAATTC
AGCAAGTTCCAAAGTATAACAAAATCTACAATTCAAATATTCATGTAATGCATTCTACTATACTGAGGATTTAAATTATATATTTTCTAGAGCACATTTA
TTTAATTAAAATTGGTCAAGAAAAGAGTTATTATAGCCTTCATTCAATGATTTTGTATTTCCATTTACGTCTTATTTTTCGGAATCAAAGGTGAATTAAT
ATATAATCTCGAC