Detailed information on CNT30324827


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30324827

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MPNISSHSQGTRYLKIYQNDVAGKSEEGRAL*

>peptide 2 (32 aa)
MGSCMVCQIEGCGGNCILVGRRALVKFTYACW*

>peptide 3 (29 aa)
VLFNVLNFLISTADLLVFADISKLDIMFT*

Sequence

>CNT30324827
GTTCTGTTCAACGTGCTTAATTTCCTGATAAGTACAGCTGATTTATTGGTATTTGCTGATATTTCAAAACTTGATATTATGTTTACCTAGGTCCGATCGA
TCAGGGAATTGGTCTAAATACATCTTTCTATATAACAACCAAATCTATCTCCTCTATTATACTGAAGCATATTTACTTTGCTATGTGTGAATCTCTGTTT
CAATTTGTTTCTATTAATTTGGTCTTAACATATATGGATGATAAATATATATCTTAATAGTTAATAATACACAATTAGTATGACGTAAGTATTTAATAAT
CATAAATTACGACATCGACAGAGTGTCCTAGAAAAGTGTCAGAAATTAATATTAGTCTTATATATTTATTGTTTTCTATTTCACTCCCTACTTTTACTAC
TTGCATATGCTCATCTTAAAGCAATCTTGGATTTTGATGTAATGCCCAGGTAAGCCTAAAGGATCAGATATCGTGCTGGAAGCAATACTGGAAGCAGAGG
TGGCTCAAAATGCCAAACATTTCTTCTCACAGCCAGGGAACCAGATACCTGAAGATATACCAAAACGATGTCGCAGGGAAGAGCGAGGAGGGTCGTGCAT
TGTAGCCGGTGTAATCAGTCGCGGGGAAGAGCCGGTGTAATCAGTTAGAACTACTTGTGCAGCTCCTTTATGAAACAAGGTTTCTCTGCAATAATGAGAA
AAGTTTAGATTCATCATATAGTCTGTGTTCTTTCTTTTTTAGCTTGTAGAGAGTTTTGAATTATAGTGAATATTGTGATGGGTTCTTGTATGGTGTGCCA
AATTGAAGGCTGTGGAGGAAATTGCATTTTAGTAGGGAGAAGAGCATTGGTTAAGTTTACATATGCGTGCTGGTGATACATAATGTAAATGATGAAGCAT
TTTTTTGTGTTGAAAAACGATTAAGTGTACAAAGCGTTGCTTTTTCATCCTTTTCCTGTCAACTATTGTGTGGTTAAGTTTATGT