Detailed information on CNT30319122


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672548Asparagus officinalisSetaria viridis13.7332.1283.74203forward
CNT30533956Asparagus officinalisEucalyptus grandis13.3228.2281.22197forward
CNT30182270Asparagus officinalisSecale cereale10.4828.0889.03155forward
CNT30292923Asparagus officinalisTriticum aestivum12.0478.0788.2178forward
CNT30222283Asparagus officinalisHordeum vulgare7.5726.6791.07112forward
CNT30437582Asparagus officinalisAegilops tauschii7.2332.4288.79107forward
CNT30249726Asparagus officinalisAvena sativa12.0422.1987.08178forward
CNT30662078Asparagus officinalisTriticum dicoccoides3.922089.6658forward
CNT304795Asparagus officinalisZea mays9.6731.6486.01143forward
CNT30683149Asparagus officinalisTriticum urartu12.0440.1888.76178forward
CNT30720963Asparagus officinalisTriticum spelta9.224.4288.97136forward
CNT30344816Asparagus officinalisEragrostis tef8.052885.71119forward
CNT30582394Asparagus officinalisEchinochloa crusgalli11.4945.5885.29170forward
CNT30556995Asparagus officinalisPanicum hallii13.7328.8884.73203forward

Expression of CNT30319122

Peptides detected in this lncRNA

>peptide 1 (62 aa)
MNLNHFYKIIVDGSLLLITTINYLVDDYDSFKSNIHRILMNYTYSYSHSKKNHSHLSTNQLL*

>peptide 2 (74 aa)
GVAEGAGLDEWAEEEETVGEADLDATEEGGDGGAVGGEVGELPRDEGGGGDGCFQAADEGVAVYGLDHWERSLL*

>peptide 3 (42 aa)
MPLINVALLIYGGYLQNVENSREFSTISKVIESFVQRTYRNY*

>peptide 4 (55 aa)
MIKYSYCYKTLQKLAQLFSLLFELLHLYNSFIELQHIQSNMYIEFGCNWNHIDLN*

>peptide 5 (35 aa)
SVLRRGPALTNGPRRRKPWARPTSMPRRRGEMAVR*

>peptide 6 (35 aa)
MGRGGGNRGRGRPRCHGGGGRWRCGRRGGWRATTR*

>peptide 7 (33 aa)
MWKILGNFLQSQKLLRVLYNVLIEIIEGFTSKC*

>peptide 8 (31 aa)
MRGEEVTGVSRLPMKGSPFMGWTTGNVACCK*

Sequence

>CNT30319122
TCGGTGTTGCGGAGGGGGCCGGCCTTGACGAATGGGCCGAGGAGGAGGAAACCGTGGGCGAGGCCGACCTCGATGCCACGGAGGAGGGGGGAGATGGCGG
TGCGGTAGGCGGGGAGGTTGGAGAGCTACCACGCGATGAGGGGGGAGGAGGTGACGGGTGTTTCCAGGCTGCCGATGAAGGGGTCGCCGTTTATGGGTTG
GACCACTGGGAACGTAGCCTGTTGTAAATAAAGGGTGGGAAAAAAAGATTTATTCAGGGTTAGATTAAGGAAATTGAGTAAATTACGCTAAACCCTTAAC
AACTTTTAGAAATCCTGCACCAAACCTCCAATAACTTTCAAATTCGCACTGAACCCCACAACAACTTTGGCAGGAAACCCCCACTATCTTCTGGGTACAA
TACACTAAACCCCGCCTTATCGTTTTCAAAATGCCTTTAATTAATGTTGCTCTTTTAATCTACGGGGGTTATCTGCAAAATGTGGAAAATTCTAGGGAAT
TTTCTACAATCTCAAAAGTTATTGAGAGTTTTGTACAACGTACTTATAGAAATTATTGAGGGGTTTACTTCAAAATGCTGAAAGTTCTTAGGTTTAGTAC
TCCTATAATAATTAACAGGAAATAGAAATGAGTTAACTGTTAAATAGCAAAATAATTTGTCAATAAAATAGAACTAATAATGTTTCGGTAGCTGTATATT
CATTTTTGTTCTATTCAAAAACTATTTCGTCTTTTTTATTATTTCTTTTTGGTGGTGGAAGATTTAATCTATCTTCAAAGAATATAAATATATTTGAAAT
ATAAATCAGCTTCTATTACCTAATAAAATATTGAATTATGTCCATTTCTTTTTATTCATTTGAGTTTTACCTTTTCATGGCCACGGCCTAGTTTAAGAAT
GTGTTTAATTAGAATAGAAGTGTGGAAAATACAGTTACAGTATCACTTAGTTCTAATTATTGCTACATGAATTTGAATCATTTCTATAAAACAGTAGTGG
ATGAATTTGAATCATTTCTATAAAATAATAGTGGATGGATCATTACTTTTAATCACAACGATTAATTATCTAGTGGACGATTATGATTCTTTTAAATCTA
ATATTCACCGTATCCTCATGAATTACACTTATTCTTATTCGCATTCAAAGAAAAATCATAGTCATCTATCAACTAATCAATTATTATGAGAAGTAGTAAT
TGCTCAACTACATTTTTTATTTCAGAGAGAATCAGAATCCTATTTCATTATGATAAAGTATAGTTATTGCTATAAAACACTTCAAAAATTAGCACAATTA
TTTTCCCTGTTATTCGAGTTACTTCACCTTTACAACAGCTTTATAGAGTTGCAACACATTCAATCAAACATGTATATTGAATTTGGATGCAATTGGAACC
ATATTGACCTAAACTAGTACTCATTTTGGAGAACCAAAAGACAAAAGAAATCAAAATTTGGGTAGAACTTTCTGACCTT