Detailed information on CNT30282


BLAST search results

BLAST vs Swiss-Prot:
sp|Q2QLY5|METE1_ORYSJ, E-value = 6e-25

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673315Zea maysSetaria viridis5024.3293.42152forward
CNT30521178Zea maysSetaria italica22.3713.9195.5968forward
CNT30504596Zea maysNicotiana attenuata48.3623.981.63147forward
CNT30711924Zea maysGlycine max49.0127.1483.22149forward
CNT30300058Zea maysTriticum aestivum21.0520.7185.9464forward
CNT30555782Zea maysOryza glaberrima49.3437.6988150forward
CNT30211728Zea maysHelianthus annuus24.0127.6584.9373forward
CNT30129110Zea maysCorymbia citriodora22.717.7891.369forward
CNT30721247Zea maysTriticum spelta31.5818.2993.7596forward
CNT30367469Zea maysSorghum bicolor46.7120.3792.25142forward
CNT3027382Zea maysPopulus trichocarpa28.9518.1882.9588forward
CNT30104764Zea maysOryza rufipogon30.5934.8386.0293forward
CNT30578457Zea maysOryza barthii49.3426.4690150forward
CNT30118059Zea maysOryza nivara30.2631.490.2292forward

Expression of CNT30282

Peptides detected in this lncRNA

>peptide 1 (94 aa)
ALASWVRMSLAAETMLVRAGLTSVYLRVLRPQSGFTQRMLVSSTASILSMRKVSLNKHIQSRKYRFKFCVCSRECSQFVRIKVEDKSGLIKLNP*

>peptide 2 (99 aa)
AGELGADELSGGDHVGQGGLDLRVLAGLEAAVGVHPEDVGVQHRQHLVDAQSKSQQAHSIQKVQIQVLRMQQRMQPICQNQGRGQEWAHQTESMKPQLPS

Sequence

>CNT30282
GCGCTGGCGAGCTGGGTGCGGATGAGCTTAGCGGCGGAGACCATGTTGGTCAGGGCGGGCTTGACCTCCGTGTACTTGCGGGTCTTGAGGCCGCAGTCGG
GGTTCACCCAGAGGATGTTGGTGTCCAGCACCGCCAGCATCTTGTCGATGCGCAAAGTAAGTCTCAACAAGCACATTCAATCCAGAAAGTACAGATTCAA
GTTCTGCGTATGCAGCAGAGAATGCAGCCAATTTGTCAGAATCAAGGTCGAGGACAAGAGTGGGCTCATCAAACTGAATCCATGAAGCCCCAGCTGCCTT
CAAC