Detailed information on CNT30265086


BLAST search results

BLAST vs Swiss-Prot:
sp|Q38857|XTH22_ARATH, E-value = 4e-80

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30546042Brassica rapaIpomoea triloba18.4424.4780.47128forward
CNT30378001Brassica rapaArabidopsis thaliana49.5727.4891.57344forward
CNT30728219Brassica rapaCorchorus capsularis49.1425.1879.77341forward
CNT30159825Brassica rapaPistacia vera15.9922.7581.98111forward
CNT30238488Brassica rapaBrassica oleracea47.5555.0996.06330forward
CNT30606514Brassica rapaGossypium raimondii13.426.9686.0293forward
CNT30650918Brassica rapaRosa chinensis22.7716.1485.44158forward
CNT30126766Brassica rapaCorymbia citriodora24.522.3182.35170forward
CNT30418479Brassica rapaPapaver somniferum16.2820.5881.42113forward
CNT30572132Brassica rapaVitis vinifera22.331481.29155forward
CNT30645714Brassica rapaCannabis sativa22.3313.2883.87155forward
CNT3033952Brassica rapaTheobroma cacao22.3336.9982.58155forward
CNT30114329Brassica rapaFicus carica22.3319.680.65155forward

Expression of CNT30265086

Peptides detected in this lncRNA

>peptide 1 (91 aa)
MFLNSLMGVPSTVKMIRCGFQRMEAVKGALDQSVLTKPPLVAQSSAFQRLEYILIGWFLGNRVPTDSMFLNSLMGVPSTVKMIRCGFQRMV*

>peptide 2 (37 aa)
VLLHPSHPFLSRRVKLLRQPRASGPLSRAIRTRRLAV*

Sequence

>CNT30265086
AGTTCTTCTGCACCCATCTCATCCTTTCTTGAGCCGTAGAGTCAAGCTCCTGCGACAGCCACGAGCCAGTGGGCCCCTGTCCCGAGCCATTAGGACAAGA
CGACTTGCCGTTTGACCAAACACAAGCTTCTTGGTTAAAGCCACGGTAGGAAGCAGTGAAAGGAGCTTTAGACCAATCGGTTTTGACCAAACCACCTCTC
GTGGCCCAATCATCAGCGTTCCAAAGACTGGAATACATTCTCATTGGTTGGTTCTTAGGAAATAGAGTACCAACAGATTCCATGTTTTTGAATTCTCTAA
TGGGAGTTCCATCGACTGTGAAAATGATTCGTTGTGGGTTCCAGAGAATGGAAGCAGTGAAAGGAGCTTTAGACCAATCGGTTTTGACCAAACCACCTCT
CGTGGCCCAATCATCAGCGTTCCAAAGACTGGAATACATTCTCATTGGTTGGTTCTTAGGAAATAGAGTACCAACAGATTCCATGTTTTTGAATTCTCTA
ATGGGAGTTCCATCGACTGTGAAAATGATTCGTTGTGGGTTCCAGAGAATGGTGTAAGTGTGGAAATCAGCTGTTGGGTCGAACCAGAGTTTGAACTGCT
GTTCTTTGTCTCCTTTGCCTTGTGTGTATACATTTGTGTGAAGTGTGTAAGGATCTCCACTTAGGTTCCCTAAGAACTCGAAGTCAATCTCGTC