Detailed information on CNT30264134


BLAST search results

BLAST vs Swiss-Prot:
sp|P29402|CALX1_ARATH, E-value = 0.0

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676354Brassica rapaSetaria viridis23.7640.8782.52206forward
CNT30517641Brassica rapaJuglans regia30.9149.8178.73268forward
CNT30377662Brassica rapaArabidopsis thaliana9793.0390.73841forward
CNT30281153Brassica rapaChenopodium quinoa47.6463.5479.42413forward
CNT30728459Brassica rapaCorchorus capsularis26.0736.4584.51226forward
CNT30629341Brassica rapaVigna unguiculata32.9926.1978.67286forward
CNT30709122Brassica rapaGlycine max14.0734.6683.61122forward
CNT30164689Brassica rapaPistacia vera23.4136.9181.77203forward
CNT30190468Brassica rapaSecale cereale38.1834.2380.97331forward
CNT30397803Brassica rapaTriticum turgidum36.3340.1381.27315forward
CNT30561418Brassica rapaActinidia chinensis45.3338.9980.41393forward
CNT30238817Brassica rapaBrassica oleracea43.0269.9897.32373forward
CNT30144554Brassica rapaMedicago truncatula37.1437.6279.81322forward
CNT30140632Brassica rapaLolium perenne12.5753.4383.49109forward
CNT30605054Brassica rapaGossypium raimondii35.2953.9779.08306forward
CNT30126269Brassica rapaCorymbia citriodora11.5326.3982100forward
CNT30686114Brassica rapaTriticum urartu18.827.2684.05163forward
CNT30349705Brassica rapaEragrostis tef35.5243.9479.87308forward
CNT30365925Brassica rapaSorghum bicolor36.5635.782.02317forward
CNT30120416Brassica rapaCitrus clementina11.346.8987.7698forward
CNT30149228Brassica rapaBrachypodium distachyon31.8358.1181.52276forward
CNT30101562Brassica rapaOryza rufipogon38.1838.3182.18331forward
CNT30585446Brassica rapaEchinochloa crusgalli15.5744.785.93135forward
CNT30116414Brassica rapaOryza nivara7.7323.9389.5567forward
CNT30333676Brassica rapaCynara cardunculus20.334.1181.82176forward
CNT30725707Brassica rapaLupinus angustifolius30.9148.6481.72268forward
CNT3048947Brassica rapaCucumis sativus22.0313.583.25191forward

Expression of CNT30264134

Peptides detected in this lncRNA

>peptide 1 (94 aa)
MGKLVIRNRGRELQMVLNVLAALGVLVLQNEMNFVRSSTLVGSKHDGVRRFTIESLRCPSSFLWTEVLQVSTTTLKPLLETNLVLKNNGSVLEV*

>peptide 2 (40 aa)
MVLSGIKAGSKSSPESRLAFFFSSPSTKILTSLSGFKMAV*

Sequence

>CNT30264134
GCATCGTCCAGATCTCTATACCGATAGCTGCAATGGGCTCGTAGTCAGGTCTGTCTAGCTCAAAGTAGTCAGGGTTAGGGATGTCTCTGGGCTTCCAGAT
TCCTTTGTAAGCAGGGTTATCAATCATAGGTGCACTCCACTTGCCCTTGTAAGCTGGGTTTTTCTTCATCGGTCTCTTCCATTCACCGCATCCTGGTGCT
GCTTCACACTTGGGGTTGTCAATCTTTGGTGCCTCCCACATACCATCTTCCTCATCATCCCAATCTTCAGGGTTGGTCGCCTCTGGGTCGTCCACCTCCT
CAGGCTTCACGGCGTTAGGGTCAGGGATCTTGGCTCTCTCATCCCAGTCTTCTGGCTTCTTGTCTTCAGGGTCAGGGATGGTCTTGTCAGGGATCAAAGC
AGGCTCAAAGTCCTCTCCAGAGAGTAGGTTAGCCTTCTTCTTCTCCTCTCCATCAACCAAGATTCTAACCTCGTTGTCTGGCTTCAAGATGGCGGTGTAG
ACATGGGAAAGCTTGTCATAAGGAACAGAGGGAGGGAACTTCAGATGGTGCTCAACGTACTCGCCGCTCTTGGGGTTCTTGTGCTTCAAAATGAAATGAA
CTTTGTTCGTAGCTCCACACTTGTCGGGTCCAAACATGATGGAGTAAGGAGATTCACTATCGAATCCCTCAGGTGTCCATCCAGCTTCCTGTGGACGGAG
GTACTTCAAGTAAGCACCACCACACTCAAGCCCCTCCTGGAAACGAACCTCGTACTGAAGAACAATGGTTCCGTCCTTGAGGTTTAGTGGCTCGTCGAGA
ACTTTAACTATACCGTACTTACGAGCCTTCTCGCTCACGAGGAGTCCATAGTCATCATGTCCTTCAC