Detailed information on CNT30263944


BLAST search results

BLAST vs Swiss-Prot:
sp|Q6QHD9|MATK_BRACM, E-value = 0.0

BLAST vs NONCODE: nothing found

Expression of CNT30263944

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MKKKVKNPSPNRACIFHCTQLSLCIHRKLSFFVSL*

>peptide 2 (88 aa)
MSIVNEKTACVEKKRWIRIHIHENYIRTIKILDSKLIFFYYQNSSNCNTRIDRTEKNAKKRHLLPGNVGFEPRFLDGWGKVLVHLIHN*

>peptide 3 (29 aa)
MEFLQSLQIKQISFDNRNYWYAPDFCSNP*

Sequence

>CNT30263944
TTTGAAAAAAAAATTCAGTACTAGTTATCCAGTTACAGAAGCGACCCCATAGGCTTTCGCTTTCGCGTCTCTCTAAAATTGCAGTCATGGTAAAATCCTT
GGTTTATTTAATCATCAGGGACTCCCAAGCACACAAATTCTCTAAAACTATAAGTAGATAATTGAGAGCTTGTTATTGAACAGTATAACATGACTTATAT
AGCCATGTCAACCAATGTAAAATGGCTAAGATCCTTTTAGTTTAGATTCATAATAATTTTTTTATCGAGGAGAGAAATTATAAACGAATCTATATACATA
GAAATATAATTTCTCTATGAATATTATTTCAAAATCATATGAATATGATCCATAGTGGGTTGCCCGGGACTCGAACCCGGAACTAGTCGGATGGAGTAGA
TAATTTCCTTGTTAAAATGAAAAAAAAAGTAAAAAACCCCTCCCCAAACCGTGCTTGCATTTTTCATTGCACACAGCTTTCTCTATGTATACATAGAAAA
CTCAGTTTCTTTGTTTCCTTATAAATAGGACTGCGAATTCAATACTCAGTAAATTTCATCTTAGTCTTACTGTATGAACATTTAATAATAGAAATAAATG
ACTTTTGATAATACAAAATAATTAATTTTTTTGTTATCTCCGCATTCCGTTTACGTTCTGATAAATTTTGATTTAATTTATGGAGCCTCAGAACCCCATT
ATTCATGATTGACTAAATCATTAAGATAAAGAATATCCAAATACCAAACCCGCACTCGATATAATCTTTTAGAAGCATAATCACTTCTTGGGAAGATTAA
AGAAAGAACTTGGTCTTCCCCCGTAAGGAATTCTTCTAATAAACCCGAGCCCAACCTTTTTAAAAAAGCGCGTACAGTACTTTTGTGTTTACGAGCCAAA
GTTTTAACACAACAAAGACGAAGTATATATTTTATTCGATACAAATTCTTTTTGTTTGAAGATCCGCTGTAATAATGCGAAATATTTCTGCATATACGCA
CAAATCGGTTGAGAATATCAGAATCTGATGAATCCGTCCAGGTCGCTTTACTAATCGGATGCCCTAATACATTACAAAATTTATCTTTAGCCAACGACCC
AATAATAGAAGAAATTGGAATGTTGCTATCCAATTTTATTCTAACATTATCTATTAGAAATGAGTTTTCTAGCATTTGACTACGTACCACTAAAGGGTTT
AGTCGCAAACTTGATAGATAACCCAGAAATTCTAAATTATCTTTAGATAATTGATTTATATTAACCTTTTGCGATTGAAACCATACGGAAAAATAACATT
GCCATAAATTAACAAAATAATATTTCCATTTATTCATCAGAAGTGGCGTATCCTTTGTTGCCAGAATGTATTTTCCATGATATCGAACATAATGTAGGAA
AGGATCCTTGAGCAACCCTAAGAGCGCCGAAAAATTATTAACAAAGACTTTAAAAAAATGTTGTATTTTTCCATAGAATAAAATTCGCTCAAAAAAGACG
TCATAAGATGTCGATCGTAAATGAGAAGACTGCTTGCGTAGAAAAAAAAAGATGGATTCGTATTCACATACATGAGAATTATATAAGAACAATAAAAATC
TTGGATTCAAAATTGATTTTTTTTTACTATCAAAATTCTTCCAATTGCAATACTCGTATAGACAGAACCGAAAAAAATGCAAAGAAGAGGCATCTTTTAC
CCGGTAACGTAGGGTTTGAACCAAGATTTCTAGATGGATGGGGTAAGGTATTAGTACATCTAATACATAATTAAAATGTGAGAGTTTGTCTTCTAAAAAG
GGAAATATTGAATGAAGTGATTGTAAATTGTAAGATTTTTTTACATTTTTTCCTTCGATAGAGGATCCCAACCTTAGGGAAAATGGAATTTCTACAATCA
CTGCAAATAAAACAGATATCATTTGATAATAGAAATTATTGGTATGCCCCAGATTTTTGTTCAAATCCTTAGTGGGAATAATCAAACGATTCTGTTCGTA
CATTCGCAAAATTAAGCGTTTCACAATTAGTGAACTATATTTTTTGTCATAATCCGCATTTTCCAAGAAAATAGGGCGGTTTCTATTTAATCTATTTAAA
CCGTGATCATAAGCAAGTACATAAATATAGTCCCGAAAAAAAAGTGGATATAGAAAACTCTGTTGACGAGCCCCATCGAACTCTAAATATCCTTGAAATT
TCTCCATTTGGATTAAAATTCGATTTGAACTAAAAGTAAAGTCTTTATTTTCTTGAGTTCTGAAATGACACATAGTGCGATACAGTCAAAATAAGGTATT
AGATTACGAAAGCACTAAATACCTCATAAACAGGTAGACTGCTAACTGGATTCTCTATCTTTAATAGGTTTCTGTTCGTTATATTATAAAATAACAAAAC
AAGATGATTAGAAATCCTTTATTTTTTTAACCTAATCGCTTTATTTATT