Detailed information on CNT30263734


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9ASR1|EF2_ARATH, E-value = 2e-140

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30263734

Peptides detected in this lncRNA

>peptide 1 (64 aa)
MTRFIKGLPIRSFSSDFIWTPSFCNIGHNLSFWSFMQVAMICLMGHNLSFWSFMQVAMICLMGS*

>peptide 2 (30 aa)
TFIPVDTLPENTRPKAKNLPLSEAGIILET*

Sequence

>CNT30263734
TGACTTTCATACCAGTGGACACCTTACCAGAGAATACACGACCAAAAGCAAAGAATCTTCCCTTGTCTGAAGCGGGAATCATCTTAGAAACATAGAGCAT
GAGCGGACCATTAGGATCACAGTTTCTGATGGCAGTGGCATACTGATCATCGAGAGGACCTTCATATAAATTCTCAACACGGTACCTCTGTGCAGTGTGG
GGGGATGGAAGGTGAAAGATCATCATCTCAAGCAATGCAGTGCTGGCAGGGAGCCAAGTCTGCATGACACGCTTCATCAAAGGTTTACCCATAAGGTCCT
TCTCATCAGACTTCATCTGGACACCAAGCTTCTGCAACATAGGCCACAACTTATCCTTCTGGTCGTTCATGCAAGTGGCGATGATCTGCTTGATGGGCCA
CAACTTATCCTTCTGGTCGTTCATGCAAGTGGCGATGATCTGCTTGATGGGTTCATAACAGAACTGCACAAACCCACGCTTGCAGGTAGCGGACCCAGTG
TTCTTGCTGCTCCATTTCCTGGTGGCAGGGTCAAAGAAGTTCTCACCCCACAGCCTCTCCATCATCTTAGTCTCGTCAACACCGAACTTGGAAGCATACA
TCTTGGCAAAGTTGGTCAGGGTGAAAGCCCATCCGTGGAGACCAGCAGAGAAGGCAACAGTTCCCTTCTCAGGGTAAACCTGAACATCACCAA