Detailed information on CNT30263622


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3020376Brassica rapaCitrullus lanatus57.5610098.44449forward
CNT3038812Brassica rapaCucumis melo88.9766.1696.11694reverse complement

Expression of CNT30263622

Peptides detected in this lncRNA

>peptide 1 (53 aa)
ACFEHSNFFKVTAPEARPGQLRPGAYRRQKRQADRCSPKADRATHPKVQLRAF*

>peptide 2 (32 aa)
MKYECPRLSLLIITPIPKANTIGSKSYDVIPC*

>peptide 3 (44 aa)
MLSQLFVFHKSKNFTSDYEIRMPPTVPVNHYSDPEGQHNRIEIL*

Sequence

>CNT30263622
AGGCTTGCTTTGAGCACTCTAATTTCTTCAAAGTAACAGCGCCGGAGGCACGACCCGGCCAGTTAAGGCCAGGAGCGTATCGCCGACAGAAGAGACAAGC
CGACCGGTGCTCACCAAAGGCGGACCGGGCGACCCATCCCAAGGTTCAACTACGAGCTTTTTAACTGCAACAACTTAAATATACGCTATTGGAGCTGGAA
TTACCGCGGCTGCTGGCACCAGACTTGCCCTCCAATGGATCCTCGTTAAGGGATTTAGATTGTACTCATTCCAATTACCAGACTCAAAGAGCCCGGTATT
GTTATTTATTGTCACTACCTCCCCGTGTCAGGATTGGGTAATTTGCGCGCCTGCTGCCTTCCTTGGATGTGGTAGCCGTTTCTCAGGCTCCACTCCTGGT
GGTGCCCTTCCGTCAATTCCTTTAAGTTTCAGCCTTGCGACCATACTCCCCCCGGAACCCAAAAACTTTGATTTCTCATAAGGTGCCAGCGGAGTCCTAA
AAGCAACATCCGCTGATCCCTGGTCGGCATCGTTTATGGTTGAGACTAGGACGGTATCTGATCGTCTTCGAGCCCCCAACTTTCGTTCTTGATTAATGAA
AACATCCTTGGCAAATGCTTTCGCAGTTGTTCGTCTTTCATAAATCCAAGAATTTCACCTCTGACTATGAAATACGAATGCCCCCGACTGTCCCTGTTAA
TCATTACTCCGATCCCGAAGGCCAACACAATAGGATCGAAATCCTATGATGTTATCCCATGCTAATGTATACAGAGCGTA