Detailed information on CNT30261189


BLAST search results

BLAST vs Swiss-Prot:
sp|P85086|RCA_ARAHY, E-value = 1e-11

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30617865Brassica rapaSesamum indicum60.4481.1885.91220forward
CNT30524690Brassica rapaPhaseolus vulgaris59.0721.5985.58215forward
CNT30223170Brassica rapaHordeum vulgare59.6244.6586.64217forward
CNT30171660Brassica rapaTrifolium pratense69.7877.6888.58254forward
CNT30144840Brassica rapaMedicago truncatula72.2584.2989.73263forward
CNT30310249Brassica rapaCamelina sativa35.1656.8993.75128forward
CNT3075041Brassica rapaBrassica juncea49.1875.53100179forward
CNT30684251Brassica rapaTriticum urartu65.6623.4887.87239forward
CNT3024431Brassica rapaPopulus trichocarpa71.4354.1782.69260forward
CNT30150829Brassica rapaBrachypodium distachyon46.1535.5988.1168forward

Expression of CNT30261189

Peptides detected in this lncRNA

>peptide 1 (99 aa)
ELLHTSITDERSVEGGEIVTGDDDGDTCVVFLVVHSWELDVGGVISNVHERCVNHLVVDSVLCGTTHTTSTSVEIVDEETTHLSFLDQVCCLAVEDGLT*

>peptide 2 (97 aa)
MMGTRALSSLLYIPGSWTLVGLSAMFMSVALTIWLLTVYCVVPPIRPAPASRSLMKRQHIFPFLIRSAASRWKMDLLDAHLGHDKLTLEGFTLTFASP

Sequence

>CNT30261189
TAGAACTTCTCCATACGTCCATCACGGATGAGAGGAGCGTAGAGGGTGGAGAAATCGTTACCGGTGACGATGATGGGGACACGTGCGTTGTCTTCCTTGT
TGTACATTCCTGGGAGCTGGACGTTGGTGGGGTTATCAGCAATGTTCATGAGCGTTGCGTTAACCATCTGGTTGTTGACAGTGTACTGTGTGGTACCACC
CATACGACCAGCACCAGCGTCGAGATCGTTGATGAAGAGACAACACATCTTTCCTTTCTTGATCAGGTCTGCTGCCTCGCGGTGGAAGATGGACTTACTT
GATGCCCATCTTGGCCATGACAAGCTCACACTGGAAGGATTTACCTTGACCTTTGCCTCCCCAA