Detailed information on CNT30260820


BLAST search results

BLAST vs Swiss-Prot:
sp|P10896|RCA_ARATH, E-value = 4e-131

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30517378Brassica rapaJuglans regia30.7832.9984.24349forward
CNT30373758Brassica rapaArabidopsis thaliana32.9899.4786.1374forward
CNT30727556Brassica rapaCorchorus capsularis32.2847.187.16366forward
CNT30628493Brassica rapaVigna unguiculata20.0228.3885.9227forward
CNT30712287Brassica rapaGlycine max31.3123.185.63355forward
CNT30185579Brassica rapaSecale cereale15.6146.3487.01177forward
CNT30295268Brassica rapaTriticum aestivum19.6654.7987223forward
CNT30235899Brassica rapaBrassica oleracea4.8521.4896.3655forward
CNT30439608Brassica rapaAegilops tauschii20.919.7586.92237forward
CNT30662818Brassica rapaTriticum dicoccoides31.4896.2385.71357forward
CNT3060691Brassica rapaArabidopsis lyrata4.8522.3694.5555forward
CNT3074698Brassica rapaBrassica juncea22.5789.2100256forward
CNT306924Brassica rapaZea mays30.9547.3783.76351forward
CNT30609928Brassica rapaGossypium raimondii16.3140.6688.65185forward
CNT30233037Brassica rapaAnanas comosus21.3480.1383.88242forward
CNT30218871Brassica rapaKalanchoe fedtschenkoi14.3737.4782.21163forward
CNT30208512Brassica rapaHelianthus annuus30.955285.75351forward
CNT30360399Brassica rapaLactuca sativa28.2246.7286.56320forward
CNT30642662Brassica rapaCannabis sativa20.7245.8191.49235forward
CNT30120246Brassica rapaCitrus clementina21.2561.7986.72241forward
CNT3038844Brassica rapaCucumis melo16.425.9188.71186forward
CNT30604727Brassica rapaOryza punctata12.8754.6889.04146forward
CNT30115081Brassica rapaEutrema salsugineum5.1120.7191.3858forward

Expression of CNT30260820

Peptides detected in this lncRNA

>peptide 1 (81 aa)
MASAFASPKAASLRYWSASWTLLTFSCSITSMFPYSISFSRVIADCPGNWSTSVTMSSSLTLSVLKIPLQTPIRSSRVGAQ*

>peptide 2 (33 aa)
MFAHDHKKREYMKQSKITQKATKKRDSSRNTAT*

>peptide 3 (39 aa)
MMGTRAFSSLLYIPGSWTLVGLSAMFMRVALTIWLLTVY*

Sequence

>CNT30260820
AATGCCATCTACTTAATAAAGCAAACAAAAAGTTGAGAAATGGTTTATGACAAGGGAATCTTACAATATTAATGTTTGCACATGATCACAAAAAAAGAGA
GTACATGAAGCAATCCAAAATTACACAAAAGGCAACAAAAAAGAGAGACAGTAGTAGAAACACAGCAACTTAACAAAGGGGAAACTCAAAAGTTGTAGAC
ACAAGTTCCATCATCACTTCTAGCTGTTGGATCAAAGTTGTCGGCTTGAGGATCAGTTCACTTGCTGTGCTGCTTTACCTGCAAGGCAAGTTACACCCAT
TTCAAAAACCCTAATTCCATTTTTATGCTCTCGTTCAAAAACGAAAAACAAAGGAGTTCAAACCTCGAGTTCTAACCATAGAAAGTTCCGCGGCCAATGG
CGTCCGCGTTTGCGTCTCCCAAGGCAGCCTCGTTAAGGTATTGGTCAGCAAGTTGGACTCTCTTGACGTTCTCTTGCTCCATCACAAGCATGTTTCCGTA
CTCCATAAGCTTCTCAAGAGTCATCGCTGATTGTCCAGGGAACTGGTCAACAAGCGTGACAATGTCTTCATCCTTAACGTTATCAGTCCTGAAGATACCC
TTGCAGACACCAATACGGTCCTCACGTGTGGGTGCCCAGTAGAACTTCTCCATACGCCCGTCACGGATGAGAGGTGCGTAGAGAGTGGAGAAATCGTTAC
CGGTGACGATGATGGGGACACGTGCGTTTTCTTCCTTGTTGTACATTCCCGGGAGCTGGACGTTGGTTGGGTTATCAGCAATGTTCATGAGGGTTGCGTT
AACCATCTGGTTGTTGACTGTGTACTGAGTAGTACCACCCATACGACCAGCACCAGCGTCGAGATCGTTGATGAATAGACAACACATTTTTCCCTTTTTG
ATCATGTCTGCTGCTTCACGGTACCTTTGACGGATCAGCTTGGCTGGTTCTCCTGCTCCCCTCCATCTGTCTCCATCGGTTTGTTTGTCTTCTTTGACAG
CGACCACTTTGAATGATCCGTTGCTCTTCTTGTTGTTGCTCTGTGTGAATCTCGACGCGGTTACAACTTTCTTTCCCAAGAAGGTCGTAGCTGGGACTGA
AGCAGCTCCTGCTCCTGACCCGTTCAAGCTCAAC