Detailed information on CNT30259345


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CH33|UBQ11_ARATH, E-value = 2e-116

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30541271Brassica rapaBrassica napus50.2744.7295.89462forward
CNT3032189Brassica rapaTheobroma cacao52.5678.2883.44483forward

Expression of CNT30259345

Peptides detected in this lncRNA

>peptide 1 (41 aa)
ATAIIFHNREIRFGSQGKRKQGRKSSSIIHQRLYKTPKHKP*

>peptide 2 (45 aa)
MRRCWSGGIPSLSWILALTLSMVSELSTSSVMVLPVKVGVGTLHL*

>peptide 3 (42 aa)
MSLCWSGGIPSLSWILALTLSMVSELSTSKVIVFPVRVLTKIC

>peptide 4 (66 aa)
MKSRLLLDVVVGKSSSILQLLAGKDEPLLVRWDSLLILDLGLNVVDGIGAFNLQSDRLSGQSFNKDL

>peptide 5 (55 aa)
QRLLYFTIEKSDLVHKERENKDARVHQLFIRGFIKPQNTNHKYFIKENQILTFNP*

Sequence

>CNT30259345
GCAACGGCTATTATATTTCACAATAGAGAAATCCGATTTGGTTCACAAGGAAAGAGAAAACAAGGACGCAAGAGTTCATCAATTATTCATCAGAGGCTTT
ATAAAACCCCAAAACACAAACCATAAGTACTTTATAAAAGAAAACCAGATTCTAACTTTTAACCCGTAACAGGCGGAGAGTTTTAGATACCACCACGGAG
ACGGAGGACCAAGTGAAGTGTCGACTCCTTCTGGATGTTGTAGTCTGCTAAGGTGCGACCATCCTCGAGCTGCTTTCCAGCGAAGATGAGACGCTGCTGG
TCCGGAGGGATACCTTCCTTGTCTTGGATCTTGGCCTTGACGTTGTCAATGGTGTCGGAGCTCTCCACCTCCAGTGTGATGGTCTTGCCGGTCAAGGTTG
GTGTCGGAACTCTCCACCTCTAGCGTGATCGTCTTTCCTGTCAAAGTCTTGACGAAGATTTGCATGCCTCCACGTAGACGCAAGACCAAGTGAAGCGTAG
ACTCCTTCTGAATGTTGTAATCAGCCAAGGTGCGACCATCCTCCAGCTGCTTTCCAGCAAAGATCAACCTCTGCTGGTCTGGTGGGATACCCTCTTTGTC
TTGGATCTTGGCTTTGACGTTGTCAATAGTGTCGGAGCTTTCAACCTCCAAAGTGATAGTCTTTCCCGTCAAAGTCTTAACGAAGATTTGCATACCACCA
CGGAGCCTGAGGACGAGATGAAGAGTCGACTCCTTCTGGATGTTGTAGTCGGCAAGAGTTCTTCCATCCTCCAACTGCTTGCCGGCAAAGATGAGCCTCT
GCTGGTCCGGTGGGATTCCCTCCTTATCCTGGATCTTGGCCTTAACGTTGTCGATGGTATCGGAGCTTTCAACCTCCAAAGTGATCGTCTTTCCGGTCAG
AGTTTTAACAAAGATCTGC