Detailed information on CNT30232978


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30232978

Peptides detected in this lncRNA

>peptide 1 (43 aa)
GLYDPSTLSSPHVPPHTLPTPLLEREEGEEEEGEEEEKDLAWA*

>peptide 2 (29 aa)
MAISGVPACRERPSQACANEHNRNKRKIRL

>peptide 3 (70 aa)
MAGLGTLPGGPLPVPGRDTRAFHAGRGQGSRKGYRLGLACLPRDRSIGGLPLAYDGSGHATGRASAGPGA*

>peptide 4 (50 aa)
MSFAHGNPLRRSIPHGEYVSRWPSPECRLVGSDPHKRVRMSTIATSVRSVS

Sequence

>CNT30232978
ATGGTCTATATGACCCATCCACCCTCTCTTCTCCTCATGTCCCTCCTCACACTCTCCCCACACCCTTGCTAGAGAGAGAAGAAGGAGAAGAAGAGGAAGG
AGAAGAAGAGGAGAAGGATCTAGCTTGGGCTTGAAGCATTCCTTTGCCTTTCTTCCTCATCCCACCTTGTTGGTGCTTGAAGGCTTGGACTTGGAGCTTG
CAAAGGAGGAGATCTTCACCGTTGGAGCTTGGACTTGAAGCTTCTAAGGAGGTTTCTCTCTTTTGGAGCATAGGAAGAGATTTTGCACTAGAGGGTATTT
TGAGACTCGTGGACAACTTCGTTCGGCGAAACGAAGCCTTACGCGACGATTCGACGCCTTATATGTGTTGACATATGGCGGGTCTGGGCACGCTACCGGG
AGGGCCTCTGCCGGTCCCGGGGCGTGACACCAGAGCCTTCCACGCAGGGAGAGGCCAGGGATCGCGAAAAGGGTATCGCCTCGGGCTAGCGTGCTTACCG
AGGGATCGTTCGATAGGTGGTCTACCTCTGGCATATGACGGGTCTGGGCATGCTACCGGGAGGGCCTCCGCCGGTCCCGGGGCGTGACAGCTGAATTTGT
CAATGTTCACTTGGCATGTTAACTACTTAAAGTTAAATCTTGGAAGACCCGCCCGAAGGCTGTCTGGCTTATAGACCCACCCGTAGGCTGTCTGGCCGGT
GCCGAGCCTAATGGCTCCGTGGTAGTCAACATCCCCACTCTAGAAATGAGCTTTGCCCACGGCAATCCACTTCGGCGCTCAATCCCGCACGGCGAATATG
TATCGCGATGGCCATCTCCGGAGTGCCGGCTTGTAGGGAGCGACCCTCACAAGCGTGTGCGAATGAGCACAATCGCAACAAGCGTAAGATCCGTCTCAA