Detailed information on CNT30232947


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691492Ananas comosusOryza sativa77.6424.2486.96184forward
CNT30676186Ananas comosusSetaria viridis31.6516.639275forward
CNT30520523Ananas comosusSetaria italica26.162.691.9462forward
CNT30640394Ananas comosusNymphaea colorata85.2340.482.67202forward
CNT30287172Ananas comosusTriticum aestivum43.4640.8789.32103forward
CNT30221117Ananas comosusHordeum vulgare28.2730.4594.0367forward
CNT30394052Ananas comosusTriticum turgidum79.7513.2183.07189forward
CNT3084566Ananas comosusVigna radiata24.8910.0291.5359forward
CNT30541063Ananas comosusBrassica napus24.897.4388.1459forward
CNT30436090Ananas comosusAegilops tauschii26.165.9693.5562forward
CNT30658930Ananas comosusTriticum dicoccoides43.4643.188.35103forward
CNT30133582Ananas comosusLolium perenne28.693491.1868forward
CNT3013604Ananas comosusZea mays26.584.693.6563forward
CNT30218729Ananas comosusKalanchoe fedtschenkoi2722.0787.564forward
CNT30129030Ananas comosusCorymbia citriodora24.891091.5359forward
CNT30681640Ananas comosusTriticum urartu29.966.0592.9671forward
CNT30366304Ananas comosusSorghum bicolor32.9115.7391.0378forward
CNT30595794Ananas comosusOryza meridionalis41.7745.2190.9199forward
CNT3024497Ananas comosusPopulus trichocarpa21.9418.5190.3852forward
CNT30325169Ananas comosusAsparagus officinalis37.9733.9686.6790forward
CNT3038708Ananas comosusCucumis melo36.716.6286.2187forward
CNT30331328Ananas comosusDioscorea rotundata27.4312.6787.6965forward
CNT30148068Ananas comosusBrachypodium distachyon26.1610.7188.7162forward
CNT30603734Ananas comosusOryza punctata87.3415.7785.02207forward
CNT3050457Ananas comosusCucumis sativus36.7115.1383.9187forward

Expression of CNT30232947

Peptides detected in this lncRNA

>peptide 1 (77 aa)
RLKAFDDAGAADGAQALHHHVEHRPRHRQLPCEQQPERHRRDVPEMPAVQYTRAKIMPPKAQAMPWIPTVEHLEGDLL

>peptide 2 (36 aa)
MCLRCRRCNIRGRKSCRRRPRRCPGYRRWSTWRGTC*

Sequence

>CNT30232947
CCCGTCTGAAAGCCTTTGACGATGCCGGCGCCGCAGATGGCGCCCAGGCACTGCATCACCATGTAGAACACCGCCCGCGTCACCGACAGCTTCCGTGCGA
GCAGCAGCCCGAACGTCACCGCCGGGATGTGCCTGAGATGCCGGCGGTGCAATATACGAGGGCGAAAATCATGCCGCCGAAGGCCCAGGCGATGCCCTGG
ATACCGACGGTGGAGCACTTGGAGGGGGACTTGCTGA