Detailed information on CNT30231904


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30304182Ananas comosusTriticum aestivum31.9525.489.22269reverse complement
CNT30104319Ananas comosusOryza rufipogon31.4723.9289.43265reverse complement
CNT30333539Ananas comosusCynara cardunculus9.8622.6893.9883forward

Expression of CNT30231904

Peptides detected in this lncRNA

>peptide 1 (36 aa)
AGNPIDKSKPFFHPHSKSFISSFFGIQVSTTGFQSR*

>peptide 2 (39 aa)
MSEPPLIKEAAAGSTTVLPMPKASSRPLLTALIGCGRLR*

Sequence

>CNT30231904
GAGCAGGGAATCCCATTGACAAAAGCAAGCCCTTCTTTCACCCCCATTCAAAGAGCTTCATTTCTTCTTTCTTCGGGATTCAAGTAAGCACTACTGGCTT
TCAGTCAAGGTAAGGGGTAAAGGTATTGGCTCCCTCTTCTACTGGCCAAGAGCCAGCTCCTGGTGGTCAGAATCTAATAACCGTGACCGTGTATATAGAT
ATCTTCGATGCTGTCATTTCGAAATGTCCGCTTCAACCGCTTTTCACCTCCCAAAAAGCTAAGTTGGCTTGACGAGCGCAGATGAGGAAGCGGGAGCAAG
AAAACCTAGTTTCTCTTTCTTTTCCAAATACTTTTTTTTTTTAGTGTTGGGGCAAAGAGAAGCGCTTTCACTACTGAGAAAGCGAACGGTCAGCGCGAGG
GTTGGACGACTTAGCCGAGCGTTAGCGAAGCCTCATTCTCATAGCGAGGCGCAGCTTTTTTCAAGGTCAAATAGACGCTTCGGAAAGGATTCCACAATAA
ATTGATCTACCACTTGCGTATCAATTAATTTCTCTACCAGGTCATAGTGGGTCATTCTCTCGGGGAGTGGCTTGTTTTGTCTCTCCAGAAGTTGGGCTAT
GCCCAAGCTGTTGCGACAGAGGTGGTTTGCGAAGGAGTGTCTGCCGGGATAGTGTCAACTATGAGTGAGCCGCCACTTATAAAAGAGGCAGCCGCAGGAT
CGACTACAGTGTTGCCGATGCCAAAAGCTTCCAGCCGTCCTTTGTTGACAGCTTTAATTGGTTGCGGGCGGCTACGTTGACAGAGACTCCTTCACTTGTA
GCGACTCAACATGCACTGGAGCCTAATGTCGGTTCGGAGCCA