Detailed information on CNT30231835


BLAST search results

BLAST vs Swiss-Prot:
sp|Q943L2|H2B11_ORYSJ, E-value = 2e-42

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693801Ananas comosusOryza sativa14.9234.7798.9797forward
CNT30674774Ananas comosusSetaria viridis36.1539.6388.09235forward
CNT30523142Ananas comosusSetaria italica18.4623.0894.17120forward
CNT30315505Ananas comosusCorylus avellana19.8528.2392.25129forward
CNT30518328Ananas comosusJuglans regia20.1525.2986.26131forward
CNT30702570Ananas comosusQuercus lobata33.6943.884.47219forward
CNT30379403Ananas comosusManihot esculenta19.3822.4286.51126forward
CNT30526697Ananas comosusPhaseolus vulgaris19.2347.5389.6125forward
CNT30630598Ananas comosusVigna unguiculata18.9222.0886.18123forward
CNT30196132Ananas comosusPisum sativum17.8524.4788.79116forward
CNT30188752Ananas comosusSecale cereale15.0847.5797.9698forward
CNT30301510Ananas comosusTriticum aestivum18.4623.7695.83120forward
CNT30226219Ananas comosusHordeum vulgare14.7741.0397.9296forward
CNT30395424Ananas comosusTriticum turgidum18.3124.7494.96119forward
CNT30565715Ananas comosusActinidia chinensis20.3116.8293.18132forward
CNT30586986Ananas comosusMusa acuminata19.0835.0391.13124forward
CNT30510004Ananas comosusSolanum lycopersicum9.6920.6688.8963forward
CNT30553165Ananas comosusOryza glaberrima3853.785.83247forward
CNT30171046Ananas comosusTrifolium pratense18.3133.5284.03119forward
CNT30435705Ananas comosusAegilops tauschii34.6246.289.78225forward
CNT30241394Ananas comosusAvena sativa1822.2994.87117forward
CNT30657146Ananas comosusTriticum dicoccoides18.3120.9995.8119forward
CNT30597299Ananas comosusFraxinus excelsior19.6923.3283.59128forward
CNT30447591Ananas comosusSaccharum spontaneum18.3121.8394.12119forward
CNT30131583Ananas comosusLolium perenne16.4625.2495.33107forward
CNT303693Ananas comosusZea mays18.1534.294.07118forward
CNT30606042Ananas comosusGossypium raimondii19.6941.9786.72128forward
CNT3066775Ananas comosusLeersia perrieri15.0825.5297.9698forward
CNT30205622Ananas comosusHelianthus annuus13.3832.2285.0687forward
CNT30129800Ananas comosusCorymbia citriodora20.1516.2793.89131forward
CNT30686967Ananas comosusTriticum urartu18.3120.4894.96119forward
CNT30719869Ananas comosusTriticum spelta18.3120.8494.96119forward
CNT30346527Ananas comosusEragrostis tef16.9252.1395.45110forward
CNT30363895Ananas comosusSorghum bicolor13.8522.8497.7890forward
CNT30619778Ananas comosusCajanus cajan37.2336.5682.64242forward
CNT30359864Ananas comosusLactuca sativa19.8531.1687.6129forward
CNT30369945Ananas comosusOryza glumipatula3835.4985.83247forward
CNT3052765Ananas comosusAmborella trichopoda35.5445.4784.42231forward
CNT3024772Ananas comosusPopulus trichocarpa19.2321.0882.4125forward
CNT30319826Ananas comosusAsparagus officinalis35.5439.2994.81231forward
CNT30149313Ananas comosusBrachypodium distachyon11.0820.6391.6772forward
CNT30101075Ananas comosusOryza rufipogon35.2332.6788.65229forward
CNT30575689Ananas comosusOryza barthii15.5427.397.03101forward
CNT30557628Ananas comosusPanicum hallii18.3121.3693.28119forward
CNT3065708Ananas comosusSelaginella moellendorffii17.8533.4388.79116forward
CNT30114697Ananas comosusEutrema salsugineum19.3820.5585.71126forward

Expression of CNT30231835

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MSLMKEFMMLMALLEMPMSGWTCLSTLKM*

>peptide 2 (37 aa)
MIHRLLLYSSHRKNYPCITSYPLIHQTIQLHNHHPKP*

>peptide 3 (48 aa)
MYYIIPTHPSNHPITQSSPKALRKREKRKKGNPRYHPHHRIEKIPIKP*

Sequence

>CNT30231835
CACAAAACAAAACCGGCAATTAATTAATGGTAATTCATCATCAAATCCCTCAAAAAAATAACAAAACAGAGAATTAAAACATGACTGATCCATCGGCGTA
CCAAGTATAAACCTTGAAATCACCCCCTTTCAATTTCAATCACAAACCAAAAGAGGTAAACTCAGCAATTACAATAAGAACACTTGATGATACACCGTCT
ACTTCTATATTCTTCACATAGGAAAAACTACCCATGTATTACATCATACCCACTCATCCATCAAACCATCCAATTACACAATCATCACCCAAAGCCCTAA
GAAAAAGGGAAAAAAGAAAAAAAGGAAACCCTAGATATCATCCCCATCATCGGATCGAGAAGATCCCCATCAAACCCTAACCCTAAGAGCTGGTGAACTT
GGTGACGGCCTTGGTGCCCTCGGAGACGGCGTGCTTGGCGAGCTCGCCGGGGAGGACGAGGCGGACCGAGGTCTGGATCTCGCGGGAGGCCTCCTGAGCG
AGCTTCTCGAAGATGTCGTTGATGAAGGAGTTCATGATGCTCATGGCCTTGCTGGAGATGCCGATGTCGGGGTGGACCTGCTTGAGCACCTTGAAGATGT
AGATCTTGTACGTCTCGCTCCCCTTCTTCGCCTTCTTCTTCTTCTTCTTG