Detailed information on CNT30231560


BLAST search results

BLAST vs Swiss-Prot:
sp|Q75KD7|AOC_ORYSJ, E-value = 1e-58

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30231560

Peptides detected in this lncRNA

>peptide 1 (44 aa)
YYQLDYLVRLAKHRHIFLFPLDYQESLKDSANQTHPKYKLLDLS*

Sequence

>CNT30231560
TATTACCAACTAGATTACTTAGTGCGTTTAGCCAAACACCGTCATATTTTTTTATTTCCATTGGATTACCAGGAATCTTTAAAAGATAGTGCAAACCAAA
CGCACCCTAAATATAAGCTGCTTGATCTCTCTTAAAGGTCCAAAACATGGCCACAAAGGCAACTACAGGCCCAGTAATTATACATACCCTCGCCCAACCA
AAATAGGAAAAAAATAAGAAGAAGAAGAAAAAGGGTCAGAAACACGATCAGAACAATAGCTACTGCACTAATCAACTACTAATACACCACACTAAAAACC
AACATACAACAATCTACAATTTTATTTTGTCCCTTCTCTTTTTTTGTCTTCAATACAGGATGAAAATTCCGTCTCCCCCGCCACCGCCGTCGCGCTAATT
GGTATAATTCTTCACTGCAGCGTGGGGCTCGGCGGCCTTGGCGTCCGGGGTGGGCTCCACGGTGGGCGAGGGCGGGAACACGATCTGCTGCAGCTTGACC
TGCCCATACACGCCCTCGAACACGCCGGAGCCGCCGGTCACCGCGAGGTACGACTCCTCGTAGGTGAGGTACGGCCCCTGCACGGAGATGTGGCCGTAGT
CACCGAAGTAGAAGCTGTAGATCGCCTCGTAGCGGTCGCCGTTCCGCTCCGGCACGTGCTGGATCAAAATGCACAGCCCCGCCGTGATCCCCAGCCGCTT
CTCCAGGTTCCCGTGATTTGATCCCAAACAGAGCAACTTTAGGGTTTAAGAAGATTCTAGAGAGCGGATCGGAGGGGAGCAAGCTCAC