Detailed information on CNT30229753


BLAST search results

BLAST vs Swiss-Prot:
sp|Q01908|ATPG1_ARATH, E-value = 2e-59

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694821Ananas comosusOryza sativa29.1615.9282.07184forward
CNT30672189Ananas comosusSetaria viridis45.1754.8186.32285forward
CNT30520671Ananas comosusSetaria italica58.1630.3682.02367forward
CNT30528786Ananas comosusEucalyptus grandis13.6320.9283.7286forward
CNT30221396Ananas comosusHordeum vulgare34.8718.5880.45220forward
CNT30554409Ananas comosusOryza glaberrima45.6420.5181.6288forward
CNT30243325Ananas comosusAvena sativa34.8732.5981.36220forward
CNT3082359Ananas comosusBrassica juncea28.3716.4479.89179forward
CNT30453817Ananas comosusSaccharum spontaneum45.3227.0684.27286forward
CNT3012827Ananas comosusZea mays45.4817.7884.67287forward
CNT30720275Ananas comosusTriticum spelta34.8734.8180220forward
CNT30363035Ananas comosusSorghum bicolor34.8731.2185.45220forward
CNT30596670Ananas comosusOryza meridionalis45.4847.3681.53287forward
CNT30102695Ananas comosusOryza rufipogon29.1617.8382.07184forward
CNT30577183Ananas comosusOryza barthii45.4826.881.53287forward
CNT30117211Ananas comosusOryza nivara45.4824.3281.53287forward

Expression of CNT30229753

Peptides detected in this lncRNA

>peptide 1 (77 aa)
MGEKAGVGVRTVSRSTVSLPSLVVRRKSSSSAASTHTPLMSQISPLGDSGSSVWITGSAFTSDTNLVYSSSTLSTSSL

Sequence

>CNT30229753
GTTGGACAATAAAGAAAAAGGCTTAATAATACATACATATTCCGTTTCAGAATCCACATTTGGCTTTCTCATGACCATAGATCAGTAATACAATTATAAC
CATCCTTACAACAGCATACATAGAGCATATCATATTTTTTTTCCTTTTCTTGGGGAGAAAATTTTGGAAATTAAATAAGTAGCACTTACAAGAAGAAGAG
AAGTTGAAAATGGCGCCGCAGCGGCGGTAGCGGCGGCAGCAAGGAAGGAAAAGAGAAGAGGTATTGATTGATTTTAGGTGAGGGCGTTGGCGCCGGCGAC
GATCTCGAGGATCTCGCCGGTGATCTTGGCCTGGCGCTCGCGGTAGAGCGGCAGCAGGGCGTCGAGGATCTGCACGGGGTCCTGCTCGAACTGCAGGATG
GGCGAGAAGGCGGGCGTGGGCGTCCGCACCGTCTCGCGCTCGACCGTGAGCCTGCCCTCCCTGGTGGTGAGGCGGAAGAGCTCGTCCTCGGCCGCGTCGA
CGCACACCCCGTTGATGTCGCAGATCTCCCCCTTGGGCGACAGCGGCAGCAGCGTGTGGATCACCGGGTCCGCCTTCACCAGCGACACGAACTTGGTGTA
CAGCAGCTCCACCTTGTCCACCTCCTCGCTC