Detailed information on CNT30229606


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CG84|UBI4P_NICSY, E-value = 0.0

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30519947Ananas comosusSetaria italica50.5776.8385.97670forward
CNT30641251Ananas comosusNymphaea colorata69.0651.7285.25915forward
CNT30274489Ananas comosusChenopodium quinoa68.6874.3583.19910forward
CNT30562217Ananas comosusActinidia chinensis51.0967.2386.26677forward
CNT30171101Ananas comosusTrifolium pratense68.9854.9683.81914forward
CNT30242602Ananas comosusAvena sativa69.2880.3188.24918forward
CNT30311150Ananas comosusCamelina sativa68.0865.3683.37902forward
CNT30461176Ananas comosusSaccharum spontaneum69.3626.9685.96919forward
CNT3067522Ananas comosusLeersia perrieri69.3674.3583.46919forward
CNT30622934Ananas comosusDaucus carota67.457.2483.54893forward
CNT30364163Ananas comosusSorghum bicolor50.1972.4488.12665forward
CNT30359535Ananas comosusLactuca sativa67.5552.9983.8895forward
CNT3033611Ananas comosusTheobroma cacao50.7959.1485.44673forward
CNT30120580Ananas comosusCitrus clementina6882.5882.91901forward

Expression of CNT30229606

Peptides detected in this lncRNA

>peptide 1 (53 aa)
MPSLSWILALTLSMVSELSTSRVMVLPVRVFTKICIPPLRRRTRWSVDSFWML*

>peptide 2 (45 aa)
MPSLSWILALTLSMVSELSTSRVMVLPVRVFTKICICKKRSSTRC*

>peptide 3 (43 aa)
EFQNQPEQQKIIIINSLCACPHKVTINTNQVTAKVVILQSKYS*

>peptide 4 (37 aa)
MVSELSTSRVIVLPVRVFTKICMPPLNLSTRWRVDSF*

Sequence

>CNT30229606
GAGAGTTTCAGAATCAACCAGAACAACAAAAGATAATTATAATAAATAGCCTTTGCGCATGCCCCCATAAAGTAACTATTAATACAAACCAAGTCACAGC
AAAGGTAGTTATACTCCAAAGCAAATACAGCTAAAACACATATATTATTACCATAAAAGCGCTTTCTTAACCCATTACTACGAGTTCACCGTTCTCAAAC
ACATAAACACATAAACAGCTAGGTTCATGCGTACACCAACCAAATACATATTGAAATACGACGAAAGCAAGCTATACTACTGCCTGCTCTAACACTTGAC
GCATAGACTCGACGACATCGCAAACACCAAAGAAACTTCATAAGACAGGAGGAGCTAAGCCACAGTCAGCTCACTGGCCACCACGGAGGCGGAGGACGAG
GTGAAGGGTGGATTCCTTCTGGATGTTGTAATCCGCCAGGGTGCGGCCATCCTCAAGCTGCTTCCCAGCGAAGATCAAACGCTGCTGGTCCGGCGGAATC
CCCTCCTTGTCCTGAATCTTAGCCTTCACATTATCAATAGTATCGGAGCTCTCAACCTCCAAGGTGATCGTCTTGCCGGTGAGGGTCTTGACAAAGATTT
GCATCCCGCCCCTCAAACGAAGAACAAGGTGGAGGGTGGACTCTTTCTGGATGTTGTAATCCGCAAGTGTGCGGCCATCCTCGAGCTGCTTCCCGGCGAA
GATCAGACGCTGCTGATCCGGGGGAATGCCCTCCTTATCCTGAATCTTGGCCTTGACATTATCGATGGTGTCGGAGCTCTCCACCTCAAGGGTAATAGTC
TTACCCGTGAGGGTCTTCACGAAAATCTGCATGCCACCCCTTAACCTCAGCACAAGGTGGAGGGTGGATTCCTTCTGAATGTTATAGTCTGCAAGGGTGC
GGCCGTCCTCGAGCTGCTTGCCAGCAAAGATCAAGCGCTGCTGGTCGGGAGGGATGCCCTCCTTGTCCTGGATCTTGGCCTTGACGTTGTCGATGGTGTC
GGAGCTCTCCACCTCAAGGGTGATGGTCTTGCCGGTGAGGGTTTTCACAAAAATCTGCATCCCTCCCCTTAGGCGAAGAACGAGGTGGAGCGTGGACTCC
TTCTGGATGTTGTAGTCGGCGAGGGTGCGGCCGTCCTCGAGCTGCTTGCCGGCGAAGATAAGCCGCTGCTGGTCCGGGGGAATGCCTTCCTTGTCCTGGA
TCTTGGCCTTGACATTGTCGATGGTGTCAGAGCTCTCCACCTCAAGGGTGATGGTCTTGCCGGTGAGGGTTTTCACGAAGATCTGCATCTGTAAGAAGAG
ATCCAGCACCAGATGTTAATCACAT