Detailed information on CNT30229088


BLAST search results

BLAST vs Swiss-Prot:
sp|P27518|CB21_GOSHI, E-value = 7e-135

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696202Ananas comosusOryza sativa61.8460.3186.25538forward
CNT30522113Ananas comosusSetaria italica60.3472.0288.38525forward
CNT30187906Ananas comosusSecale cereale52.357.0987.03455forward
CNT30298089Ananas comosusTriticum aestivum38.2848.0588.59333forward
CNT30393936Ananas comosusTriticum turgidum66.0964.6886.43575forward
CNT30589923Ananas comosusMusa acuminata34.4866.0895300forward
CNT30556099Ananas comosusOryza glaberrima43.5638.8792.08379forward
CNT30245298Ananas comosusAvena sativa62.363.8483.58542forward
CNT30665498Ananas comosusTriticum dicoccoides66.5584.0386.87579forward
CNT3010541Ananas comosusZea mays61.7267.1285.85537forward
CNT30684822Ananas comosusTriticum urartu66.4470.8386.33578forward
CNT30369866Ananas comosusOryza glumipatula37.1343.9592.57323forward
CNT30100939Ananas comosusOryza rufipogon61.4967.7289.91535forward
CNT30579096Ananas comosusEchinochloa crusgalli68.1670.689.04593forward
CNT30498674Ananas comosusDigitaria exilis36.2146.5388.57315forward
CNT30116671Ananas comosusOryza nivara45.0646.8391.33392forward
CNT30603927Ananas comosusOryza punctata43.3347.5492.31377forward

Expression of CNT30229088

Peptides detected in this lncRNA

>peptide 1 (53 aa)
MYVTGIICSSSCCKIDLWSCFTCPGRSWWRRPRRCWRWGRRGGRRGSRWGPCR*

>peptide 2 (30 aa)
MGPLPVTMAWTKNPNMENMARPRGSKAPPG*

Sequence

>CNT30229088
TAATTTATTAACATTAATAATTAATTAATCGGTAGTAGTGCTACACTTGCACACAAGAACAGTGAACAGAGAGAGGAGGAAGAGAGGAGGAGGAACAGAG
AACAAGGGGAGGAGGAGGAGGAGGAGGAGGAGGACTAGTCTTTTCTCTCGGGTCGGGGTCGGACGGCGCATGTACGTTACTGGTATCATTTGCAGCAGCA
GCTGCTGCAAAATAGACTTGTGGAGTTGTTTCACTTGCCCGGGACGAAGTTGGTGGCGTAGGCCCAGGCGTTGTTGGCGGTGGGGTCGGCGAGGTGGTCG
AAGAGGTTCTCGATGGGGCCCTTGCCGGTGACGATGGCCTGGACGAAGAATCCGAACATGGAGAACATGGCGAGGCCGAGGGGGTCGAAGGCGCCCCCCG
GGTAGATGGGGTCGAGGCCCTCGCCGCCGACGCGGTAGCCCTCGACGAAGCCCATGAGGACGACCTGGCAGGCCCAGATGGCGAGGATGCTCTGCGCGTG
GATGAGGTTGGGGTTGCCCAGGTAGTCCAGGCCCCCCTCCGAGAATATCTGCGCCCCGGCCTTGAACCACACCGCCTCCCCGAACTTCACCCCGTTCCTC
GCCAGGATCTCCGGGAACACGCACCCCAGCGCCCCCAGCATCGCCCACCGGCAGTGGATCACCTCCAGCTCCCGGTTCTTCGCGAACGTCTCCGGGTCCG
CCGACAGCCCCGCCGTGTCCCACCCGTAGTCGCCCGGGAACTCCCCGGTCAGGTACGACGGCGTCTGCTCCGAGAAGGGGCCCAGGTACTTGGGACGGTC
GGGGCCGTACCTGTTCTTTCCTGCGCATGGAGACGCGGCCCTCCGAGACGCCGACCTTGCGGACGAGCTC