Detailed information on CNT30228866


BLAST search results

BLAST vs Swiss-Prot:
sp|P12372|PSAD_SOLLC, E-value = 1e-57

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695553Ananas comosusOryza sativa26.8942.3488.09235forward
CNT30678303Ananas comosusSetaria viridis17.1642.1391.33150forward
CNT30522020Ananas comosusSetaria italica26.4348.7388.31231forward
CNT30639185Ananas comosusNymphaea colorata17.1635.1383.33150forward
CNT30515464Ananas comosusJuglans regia25.2919.9181.45221forward
CNT30630888Ananas comosusVigna unguiculata21.0527.1880.98184forward
CNT30710396Ananas comosusGlycine max24.9444.5878.9218forward
CNT30299532Ananas comosusTriticum aestivum26.0944.7185.09228forward
CNT30395090Ananas comosusTriticum turgidum26.0921.2185.09228forward
CNT30554655Ananas comosusOryza glaberrima26.8926.8688.09235forward
CNT30440464Ananas comosusAegilops tauschii26.0927.4785.09228forward
CNT30249254Ananas comosusAvena sativa26.0931.5485.09228forward
CNT30665854Ananas comosusTriticum dicoccoides26.0943.3585.09228forward
CNT301538Ananas comosusZea mays15.4524.6487.41135forward
CNT30651207Ananas comosusRosa chinensis21.427.6279.68187forward
CNT30344027Ananas comosusEragrostis tef26.8929.0887.23235forward
CNT30619829Ananas comosusCajanus cajan25.0622.2179.91219forward
CNT30596794Ananas comosusOryza meridionalis26.8935.4488.51235forward
CNT30370885Ananas comosusOryza glumipatula26.8933.8688.09235forward
CNT30570681Ananas comosusVitis vinifera25.1716.0982.27220forward
CNT30148202Ananas comosusBrachypodium distachyon16.3626.2487.41143forward
CNT30577354Ananas comosusOryza barthii26.8928.5988.09235forward
CNT30579362Ananas comosusEchinochloa crusgalli26.8926.9589.36235forward
CNT30499040Ananas comosusDigitaria exilis2329.5685.07201forward
CNT30117312Ananas comosusOryza nivara26.8929.8288.09235forward
CNT30174623Ananas comosusVigna angularis21.1721.7181.62185forward
CNT30113105Ananas comosusFicus carica25.2927.6285.52221forward
CNT30725909Ananas comosusLupinus angustifolius21.1732.9278.92185forward

Expression of CNT30228866

Peptides detected in this lncRNA

>peptide 1 (44 aa)
MAIEENERVLQEGGGIRLCCDGLLGKGGEGRELLCSVERGWEGY*

>peptide 2 (41 aa)
MRKSFKYKFPAQKIQLKQQGIDYHRTTRLQYSFRRQKLACR*

>peptide 3 (32 aa)
MRGGGAPTVLSTGGGDGRMRWISRRRGWWWEG*

Sequence

>CNT30228866
CCTTAATTTCTAACCTTAATCCCAATTAAAAAATTATTACAAAAGATACGATTTTAATATTAACAACACAAAACAGAACATTAATTATAATTATTACGAG
AGAAACTAAACTGTATGTGATGTTGGTAGCAGATGCGAAAGTCATTTAAGTACAAGTTTCCAGCGCAAAAAATACAATTAAAACAGCAAGGCATAGACTA
TCACAGAACAACAAGATTGCAGTACAGTTTTAGACGTCAAAAACTTGCTTGCCGGTGAACTTGACCTCGATGGGGCTGACGTTCTTGCCAATGGAGCGAA
AGTTTATTCCGACACCCTGGCGGCCCGGGTTGACCTTCTCCGGGTAGATGCCATCCTTGGGGTGGAGGTACTGCACCTCGCCATTCGGAAACACGCGATA
GAACTGGTAGTTAATCTTGTACTTGGACCGCAGCCGTGTGCCCAGCGCCAGGCACTGCTCCTTGCGCGCCAGCTTCAGCAGGCCCCCCGTGCTGCCTCCG
AAGATTGGGGAGGGGGTGTTCGGGTCCAGCTGCGGAGGGGTGAAGCCCGCGGGGGCCTCCGGTTCCGCTGTGGCGGCCTTCTCATCGGTTGCGGAGATTC
TATATGCGAGGCGGCGGGGCGCCGACGGTGCTTTCCACGGGAGGAGGTGACGGGAGGATGCGGTGGATTTCGCGGCGGAGAGGGTGGTGGTGGGAGGGGT
GAAGAGGGAGGCTTGGGTGGTCGCCATGGCCATTGAGGAGAATGAAAGAGTGCTTCAGGAAGGTGGGGGGATTAGATTGTGTTGTGATGGGTTGCTAGGA
AAAGGAGGAGAGGGAAGGGAGCTGTTATGCTCTGTGGAGAGAGGTTGGGAGGGATATTAGGATATGTGGTGGGG