Detailed information on CNT30228221


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30228221

Peptides detected in this lncRNA

>peptide 1 (44 aa)
SRRATSFVHPLHMSAIMQSGRRCWLRRSASKGSFSSFMASKKGL*

>peptide 2 (80 aa)
ADEQRPSSTRCTCRRSCNRGAGVGSAEALLRVPLAASWRRRRACSTPGRRGGRCSRTPRVGRTRRRGTGARRTRRGGSTF*

>peptide 3 (29 aa)
PTSNVLRPPVAHVGDHAIGAPVLAPQKRF*

>peptide 4 (81 aa)
MFSDPSGRPNSAQGNRSSTNSTGRFDLLTRSMMVRMRAALTGVVMRVTRTPRSARRRAMSTMGIMCPCAARGTNTKCGVTSF

Sequence

>CNT30228221
AGCCGACGAGCAACGTCCTTCGTCCACCCGTTGCACATGTCGGCGATCATGCAATCGGGGCGCCGGTGTTGGCTCCGCAGAAGCGCTTCTAAGGGTTCCT
TTAGCAGCTTCATGGCGTCGAAGAAGGGCTTGTAGTACGCCGGGGAGGAGAGGAGGTCGATGTTCTCGGACCCCTCGGGTAGGCCGAACTCGGCGCAGGG
GAACCGGAGCTCGACGAACTCGACGGGGAGGTTCGACCTTCTGACCCGGTCGATGATGGTCCGGATGCGCGCGGCGTTGACCGGGGTGGTGATGAGGGTG
ACGCGGACGCCGCGCTCCGCGAGGAGGCGCGCCATGTCGACCATGGGGATCATGTGCCCCTGCGCCGCGAGAGGAACCAACACGAAGTGCGGAGTTACGT
CCTTCA