Detailed information on CNT30227885


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9SCM3|RS24_ARATH, E-value = 3e-49

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30522235Ananas comosusSetaria italica40.539.1585.4137forward
CNT30708364Ananas comosusGlycine max22.4917.2785.5376forward
CNT30157936Ananas comosusPistacia vera36.985.9486.4125forward
CNT30440750Ananas comosusAegilops tauschii57.6940.4688.72195forward
CNT3075029Ananas comosusBrassica juncea24.5621.8483.1383forward
CNT30450215Ananas comosusSaccharum spontaneum36.099.1586.07122forward
CNT30362959Ananas comosusSorghum bicolor36.0950.8384.43122forward
CNT30153003Ananas comosusPrunus persica37.2858.8884.92126forward

Expression of CNT30227885

Peptides detected in this lncRNA

>peptide 1 (74 aa)
LTKLPRVLVEPREEHLTPSPTWPLPSPTTTKALNRVRWPARVCFWTGMIFMTSSLRPETRVSTIWCSFTGREWR*

>peptide 2 (59 aa)
LDEVAEGLGGAAGGALDAEPDVAVAVADDNEGLESRALARAGLLLDGHDLHDLVLEAGD*

>peptide 3 (33 aa)
MLRIFPSFTRRPSFVTGTHFSSSWRGPPPRPPPP

Sequence

>CNT30227885
CCTTGACGAAGTTGCCGAGGGTCTTGGTGGAGCCGCGGGAGGAGCACTTGACGCCGAGCCCGACGTGGCCGTTGCCGTCGCCGACGACAACGAAGGCCTT
GAATCGCGTGCGCTGGCCCGCGCGGGTCTGCTTCTGGACGGGCATGATCTTCATGACCTCGTCCTTGAGGCCGGAGACTAGGGTTTCCACGATCTGGTGC
TCCTTCACGGGGAGGGAGTGGAGGTAGATCTGCTCCATGCTCCGGATCTTCCCCTCCTTCACCAGGCGCCCTAGCTTCGTCACGGGCACCCACTTCTCCT
CCTCCTGGCGGGGGCCACCGCCGCGCCCACCGCCGCCG