Detailed information on CNT302268


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT302268

Peptides detected in this lncRNA

>peptide 1 (94 aa)
HYLHRRDPVALGPAQEDGVLLCSYDTVHLLLLVRPERQQLRRPIHLLKRAVRAREEHLIVEAGVHFEAEDGEVRALVAGDLVVPAVAVGMGRLLV

>peptide 2 (46 aa)
TTYTDETLWLWGPRRKTASFCAPMTRSTCCSSSAPNASSFAGLSIF*

Sequence

>CNT302268
GCACTACTTACACCGACGAGACCCTGTGGCTCTGGGGCCCGCGCAGGAAGACGGCGTCCTTCTGTGCTCCTATGACACGGTCCACCTGCTGCTCCTCGTC
CGCCCCGAACGCCAGCAGCTTCGCCGGCCTATCCATCTTCTGAAGCGCGCTGTTCGTGCCCGCGAGGAACACCTTATCGTCGAAGCTGGCGTTCACTTCG
AAGCAGAGGACGGCGAGGTGCGGGCACTCGTCGCCGGTGATCTCGTAGTGCCTGCCGTGGCTGTTGGAATGGGTCGGCTTCTTGTCCG