Detailed information on CNT30217899


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT004405, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30730459Kalanchoe fedtschenkoiCorchorus capsularis48.4792.5788.231096forward

Expression of CNT30217899

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MRPGRMWNGKSRSADRIGVWTDADCGGGPSPGC*

>peptide 2 (34 aa)
MPAGGRIGNGSSGGVPRASNRQLRTGTDKGNPPV*

>peptide 3 (30 aa)
MCASQLARKPGWRNEVDWQDPCPGYTADRP*

>peptide 4 (93 aa)
MEQCTQGKSAKWNGNLGKRIGSEGKVRGSQSRVNSSSYFYGESGSPYAGRGTDWEWLLWGRSPGVEQTAQNWYGQGESACLIKTKHCDGPCGC*

>peptide 5 (79 aa)
MARAGPPIESGCGPMQIAAAAQAQAVDMPTGTSSPRLWKAARAASGCFGTCALRASACGLPIRSVLKHGPRSPTCVRVN*

>peptide 6 (41 aa)
MRPIPGRRGKSQAPMSRRARQSPHPLGREPGCSGRRCRSWW*

Sequence

>CNT30217899
GGTCAGGCGGGACTACCCGCTGAGTTTAAGCGATCAATAAGCGGAGGACAAGAAACTTACTAAGGATTCCCTTAGTAACGGTGAGCGAACCGGGGATAGC
CCAGCTTGTAAATCAGGAGGTCATGCTGTCTGAATTGTAGTCTGGAGAAGCGTCCTCAGCGGCAGACTGGGCCCAAGTCCCCTGGAAGGGGGCGCCGGAG
ACGGTGAGAGCCCCATCGTGCCCAGACCCTGTTGCACTACGAGGCGCTGCCGTCGAGTCGGGTTGATTGGGAATGCAGCCCTAATCAAGCTGTAAATTCC
GTCCAACACTAAATACTGGCGAGAGACAGATAGCAAACAAGTACCGCAAGGGAAAGATGAAAAGGGCTTTGAAAAGAGAGTCAAAGAGTGCTTGAAATTG
TCGGGAGGGAAGCAAATAGAGGCCAGCGATGCGCCCCGGTCGGATGTGGAATGGCAAGAGCCGGTCCGCCGATCGAATCGGGGTGTGGACCGATGCAGAT
TGCGGCGGCGGCCCAAGCCCAGGCTGTTGATATGCCCACAGGGACATCGTCGCCGCGATTGTGGAAGGCAGCGCGCGCCGCCTCGGGGTGCTTCGGCACC
TGCGCGCTCCGGGCATCGGCCTGTGGGCTCCCTATTCGGTCCGTCTTGAAACACGGACCAAGGAGTCCGACATGTGTGCGAGTCAACTAGCAAGAAAACC
CGGATGGCGCAACGAAGTTGATTGGCAGGATCCCTGTCCGGGGTACACCGCCGACCGACCTTGATCTTCTGGGAAGGGTTCGAGTGTGAGCATGTCTATC
GGGACCTAAAAGATGGTGAACTATGAGTGAGCGGGGCGAAGCCAGAGGAAACTCTGGTGGAGGCCCGCAGCGATACTAACATGTGCAAATCGTTCGTCTG
ACTTGGGTATAGGGGCAAAGACTAATCGAACCATCGTAGCTGGTTCCCCCCAAAGTTTCCCTCAAGATAGCTGGAGTCCGCGTGCGAGTTCTATTGGGTA
AAAACCAATGATTAGAGGCATCTGGGGCGCAACGCCGTCAACCTATTCTCAAAATTTAAATAGGTAGGACAGTGCGGCTGCTTCATTGAGCCCAACTGCA
CGCTAACCTCGATCCCAGAAAGGGTGCTGGTCGATTAAGACAGCAGGACGGTGGTCATGGAAGTCGAAATCCGCTAAGGAGTGTGTAACAACTCACCTGC
CGAATCAAGTAGCCCGGAAAATGGATGGCGCTTAAGCATGCGACCTATACCCGGCCGTCGGGGCAAGAGCCAGGCCCCGATGAGTAGGAGGGCGCGGCAG
TCGCCGCATCCCCTGGGGCGCGAGCCTGGGTGTAGCGGCCGTCGGTGCAGATCTTGGTGGTAGTAGCAAATGTTCAAATGAGAACTTTGAAGGCCGAAGA
GGGGAAAAGTTCCATGTGAACGGCACTTGCACATGGGTTAGTCAATCCTAAGTGACGGGGGAAGCCTGTCTTATAGTGCGTTCAACACGAGCTCGAAAGG
GAATCGGGTTAAAATTCCTGAACCGGGACGTGGCAGTTGACGGCAACGTTAGGGAGTCCGGAGACGTCGTCGAGGGCCTCGGAAAGAGTTATCTTTTCTG
TTTAACAGTCTGCCCACCTTGGAAAGGGCTCAGCCGGAGGTAGGGTCCAGTGGCTGGAAAAGAAGCACAAGTCTTGTGGTCTCCGGTGCGCTCTCGGTGG
CCCTTGAAAATCCGGAGGACCAAGTGCCGATCACGCCCGGTCGTACTCATAACCGCATCAGGTCTCCAAGGTGAACAGCCTCTGGTCGATGGAACAATGT
ACACAAGGGAAATCGGCAAAATGGAACGGTAACCTCGGGAAAAGGATTGGCTCTGAGGGCAAGGTTCGGGGGTCCCAGTCCCGAGTGAACTCCTCAAGCT
ACTTCTACGGCGAGAGCGGGTCACCCTATGCCGGCCGGGGGACGGATTGGGAATGGCTCCTCTGGGGGCGTTCCCCGGGCGTCGAACAGACAGCTCAGAA
CTGGTACGGACAAGGGGAATCCGCCTGTTTAATTAAAACAAAGCATTGCGATGGTCCTTGCGGATGTTAACGCAATGTGATTTCTACCCAGTGTTCTGAA
TGTCAAAGTGAAGAAATTCAACCAAGCGCGGGTAAACGGCGGGAGTAACTATGACTCTCTTAAGGTAGCCAATTGCCTCGTCATCTAATTAGTGAAGCGC
ATTATTGGATTAACGAGATTCCCACTGTCCTTGTCTACTATCTCGAAAACGTGATAGTTCG