Detailed information on CNT30217673


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30355905Kalanchoe fedtschenkoiLactuca sativa29.8616.7687.363forward

Expression of CNT30217673

Peptides detected in this lncRNA

>peptide 1 (69 aa)
LHVPTMALSITQYIFSKGKLSACFSSSSGSAQLDDQYTYPLTNIPFLASSDSPSPVFSVASTSDCPPDKN

Sequence

>CNT30217673
CCTCCATGTCCCAACTATGGCATTAAGCATTACACAATACATTTTTTCTAAAGGAAAGTTGTCTGCCTGCTTTTCATCATCATCAGGTTCTGCGCAGCTG
GACGATCAGTACACGTATCCCTTGACGAACATCCCCTTCTTGGCCTCGTCGGACTCGCCCTCCCCGGTGTTCAGCGTCGCCTCCACCTCCGATTGCCCTC
CCGACAAAAAC