Detailed information on CNT30216750


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONSLYT000794, E-value = 7e-27

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30315993Kalanchoe fedtschenkoiCorylus avellana92.8645.3680455forward
CNT30549101Kalanchoe fedtschenkoiIpomoea triloba50.6142.0381.85248forward
CNT30516897Kalanchoe fedtschenkoiJuglans regia92.2451.1380.09452forward
CNT30376704Kalanchoe fedtschenkoiArabidopsis thaliana77.5548.2279.74380forward
CNT30500730Kalanchoe fedtschenkoiCoffea canephora37.7621.4183.24185forward
CNT30616482Kalanchoe fedtschenkoiSesamum indicum68.5722.0382.14336forward
CNT30267763Kalanchoe fedtschenkoiChenopodium quinoa64.6945.4881.7317forward
CNT3021333Kalanchoe fedtschenkoiCitrullus lanatus9074.4980.27441forward
CNT30727661Kalanchoe fedtschenkoiCorchorus capsularis76.3359.7480.21374forward
CNT30378927Kalanchoe fedtschenkoiManihot esculenta68.9854.678.99338forward
CNT30403468Kalanchoe fedtschenkoiBeta vulgaris59.3937.681.44291forward
CNT30524932Kalanchoe fedtschenkoiPhaseolus vulgaris53.0655.4480.38260forward
CNT30628928Kalanchoe fedtschenkoiVigna unguiculata53.0652.181.54260forward
CNT30506120Kalanchoe fedtschenkoiNicotiana attenuata79.866.8479.28391forward
CNT3042435Kalanchoe fedtschenkoiPrunus dulcis71.4350.5880.57350forward
CNT30308418Kalanchoe fedtschenkoiTriticum aestivum32.6522.1984.38160forward
CNT30400271Kalanchoe fedtschenkoiTriticum turgidum40.239.881.22197forward
CNT3087851Kalanchoe fedtschenkoiVigna radiata34.0818.2783.83167forward
CNT30234460Kalanchoe fedtschenkoiBrassica oleracea79.3955.3379.18389forward
CNT30145737Kalanchoe fedtschenkoiMedicago truncatula32.2425.6584.18158forward
CNT30256655Kalanchoe fedtschenkoiAvena sativa44.4948.5582.57218forward
CNT30312353Kalanchoe fedtschenkoiCamelina sativa75.7190.4979.25371forward
CNT3062262Kalanchoe fedtschenkoiArabidopsis lyrata77.5569.3478.68380forward
CNT3079663Kalanchoe fedtschenkoiBrassica juncea44.4940.9882.11218forward
CNT30468540Kalanchoe fedtschenkoiSaccharum spontaneum54.0830.680.38265forward
CNT30141877Kalanchoe fedtschenkoiLolium perenne32.6535.7186.25160forward
CNT3017147Kalanchoe fedtschenkoiZea mays74.6951.1981.42366forward
CNT30608057Kalanchoe fedtschenkoiGossypium raimondii73.2760.5481.06359forward
CNT3067990Kalanchoe fedtschenkoiLeersia perrieri62.8680.8480.52308forward
CNT30205386Kalanchoe fedtschenkoiHelianthus annuus66.5345.5980.98326forward
CNT30713436Kalanchoe fedtschenkoiMalus domestica golden50.6177.0281.05248forward
CNT30625547Kalanchoe fedtschenkoiDaucus carota70.4133.2481.74345forward
CNT30688162Kalanchoe fedtschenkoiTriticum urartu32.6523.8183.75160forward
CNT30341751Kalanchoe fedtschenkoiEragrostis tef57.3558.0682.21281forward
CNT30476941Kalanchoe fedtschenkoiArabidopsis halleri77.5547.4479.47380forward
CNT30596736Kalanchoe fedtschenkoiOryza meridionalis59.1838.4179.66290forward
CNT30354603Kalanchoe fedtschenkoiLactuca sativa61.6344.6181.46302forward
CNT30370935Kalanchoe fedtschenkoiOryza glumipatula58.5729.6579.79287forward
CNT30154934Kalanchoe fedtschenkoiPrunus persica71.4375.7680.86350forward
CNT30410142Kalanchoe fedtschenkoiPapaver somniferum81.4360.6481.45399forward
CNT30573979Kalanchoe fedtschenkoiVitis vinifera91.6377.0278.84449forward
CNT30705868Kalanchoe fedtschenkoiPrunus avium92.8642.8479.78455forward
CNT30642143Kalanchoe fedtschenkoiCannabis sativa73.8888.0879.28362forward
CNT30109704Kalanchoe fedtschenkoiOryza longistaminata33.0629.1482.72162forward
CNT3035176Kalanchoe fedtschenkoiCucumis melo62.2455.4580.66305forward
CNT30330867Kalanchoe fedtschenkoiDioscorea rotundata52.4535.5580.16257forward
CNT30150463Kalanchoe fedtschenkoiBrachypodium distachyon68.3738.1180.6335forward
CNT30103004Kalanchoe fedtschenkoiOryza rufipogon54.926.9880.67269forward
CNT30577473Kalanchoe fedtschenkoiOryza barthii58.5752.6679.44287forward
CNT30497905Kalanchoe fedtschenkoiDigitaria exilis64.6935.1179.81317forward
CNT30114394Kalanchoe fedtschenkoiFicus carica46.3338.1578.41227forward
CNT30335475Kalanchoe fedtschenkoiCynara cardunculus62.2423.4881.31305forward
CNT3049544Kalanchoe fedtschenkoiCucumis sativus62.4538.280.07306forward

Expression of CNT30216750

Peptides detected in this lncRNA

>peptide 1 (81 aa)
MQAMWGCKKAMWGCRKATWGCRTERWDCMTGRWDCKKETSGYMMVMLGCKQVMWGCRRGRWDCRQGRWGCSWERSGYNLAM*

Sequence

>CNT30216750
CTGTAATTAGGTGAAGTTGGACTGTATGAACCAGGTGACATTCTTGGACTGCTGGGTGAGTATGCCTGCGACGGGCTGTACTTAGCAGATGAAGGATTAT
AACTAGGGGATGTAGGACTGTAACTTGGGGAGGTAGGACTGTATCCCGGAGAAGTAGGACTGTATGCAGGCGATGTGGGGCTGTAAGAAGGCGATGTGGG
GCTGTAGGAAGGCGACGTGGGGCTGTAGGACGGAGAGGTGGGACTGTATGACGGGGAGGTGGGACTGTAAGAAGGAGACGTCGGGCTATATGATGGTGAT
GTTGGGCTGTAAGCAGGTGATGTGGGGCTGTAGGCGGGGGAGGTGGGACTGTAGGCAGGGGAGGTGGGGCTGTAGCTGGGAGAGGTCGGGCTATAACTTG
GCGATGTAGGGCTATAACTTGGTGAGGTGGGGGAATAAGAGGGACTAGTAGGCGAATAGGCCGGACTGGTTGGGCTATAACCAGGAGAGC