Detailed information on CNT3021542


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CD57|NU2C2_VITVI, E-value = 7e-128

BLAST vs NONCODE:
NONVVIT001950, E-value = 4e-109

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30690671Citrullus lanatusOryza sativa98.1531.7195.9585forward
CNT30488794Citrullus lanatusOlea europaea10.9129.9598.4665forward
CNT3059312Citrullus lanatusArabidopsis lyrata53.0257.6698.73316forward
CNT30204212Citrullus lanatusHelianthus annuus20.323.3195.87121reverse complement
CNT30623007Citrullus lanatusDaucus carota30.8739.4897.28184forward
CNT30687250Citrullus lanatusTriticum urartu34.5623.5295.15206forward
CNT30153781Citrullus lanatusPrunus persica10053.4198.15596forward
CNT30425623Citrullus lanatusPapaver somniferum18.4624.1291.82110forward
CNT30150988Citrullus lanatusBrachypodium distachyon29.5310.0894.32176forward
CNT3099667Citrullus lanatusOryza rufipogon42.9511.1695.31256forward
CNT30575988Citrullus lanatusOryza barthii48.6620.4794.83290forward

Expression of CNT3021542

Peptides detected in this lncRNA

>peptide 1 (49 aa)
MLITKLVEEMKYNQGISFLSEVESIIRRRIRPKIRIHSGKIKLPSKRSK*

Sequence

>CNT3021542
GACCATTTACTATTTCTTGAAGCTCGATCTCTCCCCCGGATGAACCATATAGCCAAGAGAAACCATAAACCAGAATAGAAGAACTTGCCCCACCCATGAG
TAAATATTTCGTAGTAGCCTCATTAGACCGTACATCTTTCTTGGTATATCCAGATAATAGGTAGGAGCATAAACTGAAACATTCTGGAGCTACAAAGATA
GTTATTAAATCATTAGCACCGCATAAAAACATTCCTCCTAGAGTAGCTGTTAATACGAATAACAGAAACTCTGTTATAGCCATTTCTGTACATTCAATGT
ACTCTACGGATAGAGGAATACATAGAGTTGAACATAGTAAAATAAGAAATTGAAAGATTTCGTTGAAATTGTTCGTTTGGAAATTTCCCGAAAAGCTAAT
CATAGGTTCTTCTCTCCATCGGAACAATAGGGCCGTTATGCTCATTACTAAACTTGTTGAAGAGATGAAATATAACCAAGGTATATCTTTTTTATCAGAG
GTTGAATCGATCATCAGAAGAAGAATTAGGCCAAAAATTAGGATACATTCTGGGAAAATAAAACTTCCATCGAAGAGAAGCAAATGAAAGGCTTTC