Detailed information on CNT3021516


BLAST search results

BLAST vs Swiss-Prot:
sp|A4GYN8|RR12B_POPTR, E-value = 2e-52

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30690834Citrullus lanatusOryza sativa19.4739.9688.83358reverse complement
CNT30677883Citrullus lanatusSetaria viridis47.3158.3194.02870forward
CNT30730658Citrullus lanatusCorchorus capsularis27.8465.2293.55512forward
CNT30406883Citrullus lanatusBeta vulgaris7.3452.5391.85135forward
CNT30524944Citrullus lanatusPhaseolus vulgaris34.5363.7694.96635forward
CNT30201818Citrullus lanatusPisum sativum19.5826.1494.44360forward
CNT30492881Citrullus lanatusOlea europaea17.9451.1690330forward
CNT30502643Citrullus lanatusNicotiana attenuata27.4138.9286.9504forward
CNT30710142Citrullus lanatusGlycine max9.4639.0195.98174forward
CNT30163195Citrullus lanatusPistacia vera12.5699.1488.74231reverse complement
CNT30191576Citrullus lanatusSecale cereale19.0989.5488.6351reverse complement
CNT30300194Citrullus lanatusTriticum aestivum47.0441.1194.34865forward
CNT30384007Citrullus lanatusTriticum turgidum22.5747.5490.6415forward
CNT30569656Citrullus lanatusActinidia chinensis19.1441.8197.44352forward
CNT3083498Citrullus lanatusVigna radiata9.2473.2887.65170reverse complement
CNT30543269Citrullus lanatusBrassica napus20.1212.589.19370forward
CNT30509374Citrullus lanatusSolanum lycopersicum5.2748.592.7897forward
CNT3082974Citrullus lanatusBrassica juncea32.6870.7185.19601reverse complement
CNT3018194Citrullus lanatusZea mays25.2979.3593.33465forward
CNT30610477Citrullus lanatusGossypium raimondii17.7848.2393.58327forward
CNT30228329Citrullus lanatusAnanas comosus11.299.5295.15206forward
CNT30213923Citrullus lanatusHelianthus annuus6.7423.7194.35124reverse complement
CNT30684722Citrullus lanatusTriticum urartu15.9327.4691.47293forward
CNT30351849Citrullus lanatusEragrostis tef7.8336.1893.06144reverse complement
CNT30355468Citrullus lanatusLactuca sativa29.5344.496.87543forward
CNT30416238Citrullus lanatusPapaver somniferum37.6390.3495.38692forward
CNT30644293Citrullus lanatusCannabis sativa5.4431.1596100forward
CNT30319059Citrullus lanatusAsparagus officinalis35.1879.5889.49647forward
CNT30331679Citrullus lanatusDioscorea rotundata9.5725.6996.59176forward
CNT30150789Citrullus lanatusBrachypodium distachyon14.4632.288.72266forward
CNT30100515Citrullus lanatusOryza rufipogon12.7292.1390.17234reverse complement
CNT30578120Citrullus lanatusOryza barthii24.4778.1292.67450forward
CNT30604848Citrullus lanatusOryza punctata6.0934.2591.07112reverse complement
CNT30550344Citrullus lanatusOryza brachyantha12.2996.1788.94226reverse complement
CNT30726897Citrullus lanatusLupinus angustifolius23.4492.0990.02431reverse complement

Expression of CNT3021516

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MTYVVLKGYLYDPIDCVKPAVATEPGKVYRKDSSFLFY*

>peptide 2 (39 aa)
MRLCTLRIGIHFLKDSGFRALVGLRDPFDDLCCVEGISI*

Sequence

>CNT3021516
GTTAGTACCTCGACGTGACATGAGCGTGAAAGGGGTTCAAGAATAAGTTTTCTTTTTATAAGGGCTAAAATCATTTATTTTGGCTTTTTGACCCCATATT
GTAGGGTGGATCTCGAAAGATATGAAAGATCTCCCTCCAAGCCGTACATACGACTTTCATCGAATACGGCTTTCCACAGAATTCTATATGTATCTATGAG
ATCGAGTATGGAATTCTGTTTACTCACTTTAAATTGAGTATCCGTTTCCCTCCCTTTCCTGCTAGGATTGGAAATCCTGTATTTTACATATCCATACGAT
TGAGTCCTTGGGTTTCCGAAATAGTGTAAAAAGAGGTGCTTCGAATCATTACTATTTGACTCGGACCTGTTCTAAAAAAGTCGAGGCATTTCGAATTGTT
TGTTGACACGGACAAAGTCAAGGAAAACCTCTGAAATTATTTCAATATTGGACCTTGGACATATAATAGTTCCGAATCGAATCTCTTTAGAAAGAAGATC
TTTTGTTTGTCTCATGGTAGCCTGCTCCAGTTCCCTTACGAAACTTTCGTTATTGGGTTAGCCATACACTTCACATGTTTCTAGCGATTCACATGGCATC
ATCAAATGATACAAGTCTTGGATAAGAATCTACAACGCACTAGAACGCCCTTGTTGACGATCCTTTACTCCGACAGCATCTAGGGTTCCTCGAACAATGT
GATATCTCACACCGGGTAAATCCTTAACCCTTCCCCCTCTTACTAAGACTACAGAATGTTCTTGTAAATTATGGCCAATACCAGGTATATAAGCAGTGAT
TTCAAATCCCGAGGTTAAGCGTACTCTGGCAACTTTACGTAAGGCAGAGTTTGGTTTTTTGGGGGTGATAGTGGAAAAGTTGACAGATAAGTCACCCTTA
CTGCCACTCGACAGAACCGTACGTGAGATTTTCACCTCATACGGCTCCTCGTTCAATTCTTTCGAAGTCATTGGATCCTTTTCCTCGTTCGAGAATCTCC
TCCCTTCTTCCATTCCGTCCCGAAGAGTGACCGGGACCAATTCAGTCACGTTTTCATTCATTTGGAATCTGGGCTCTTCTACGTCATTTTTATTTACTTA
TTTTTCCCTCTCTTTTTTTTTCTTTTTTTATTCCCTTCGATCATTCCTTAAGTCCCATAGGTTTGATCCTGTAGAATCTGACCCATTTTTTCATTGAGCG
AAAGGTACGAAATAAATCAGATTGATTTTTCGATCAAAAGTACTATGTGAAATCTTCGTTTTTTTCCTCTTTCTCTATCCCTATCCCGCGGGTACAGTGT
TTGAATCAATAGAGAACCTTTTCTTCTGTATCTGTATGAATCGATATTATTACATTCCAATTCCTTCCCGATACCTCCCAAGGAAAATTCCGAATTGGAT
CCAAAATTGACGGGTTAGTGTGAGCTTATCCATGCGGTTATGCACTCTTCGAATAGGAATCCATTTTCTGAAAGATTCTGGCTTTCGTGCTTTGGTGGGT
CTCCGAGATCCTTTCGATGACCTATGTTGTGTTGAAGGGATATCTATATGATCCGATTGATTGCGTAAAGCCCGCGGTAGCAACGGAACCGGGGAAAGTA
TACAGAAAAGACAGTTCTTTTCTATTCTATTAGTATTAGATTAGTATTAGTTAGTGATCTCGGCTCAGTGAGTCCTTTCTTCCGTGATGAACTGTTGGCA
CCAGTCCTCCATTTTGTCTCTGTGGATCGAGGAGAAAGGGGGCTCGGCGGGAAGAGGATTGTAACATGAGAGTCCAACTACATTGCATTGCCAAAATCCA
TGTTGTATATTTGAAAGAGGTTGACCTCCTTGCTTCTCT