Detailed information on CNT30215137


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCSAT001427, E-value = 5e-127

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30215137

Peptides detected in this lncRNA

>peptide 1 (43 aa)
MSTTGRGRHSVLRIFKGRRGRTGHRATCGALPAVRPYLRLSRF*

Sequence

>CNT30215137
ATCAGAGCACTGGGCAGAAATCACATTGCGTTAGCATCCGCAGGGACCATCGCAATGCTTTGTTTTAATTAAACAGTCGGATTCCCCTTGTCCGTACCAG
TTCTGAGTTGGCTGTTCACCTTGGAGACCTGATGCGGTTATGAGTACGACAGGGCGTGGGAGGCACTCGGTCCTCCGGATTTTCAAGGGCCGTCGGGGGC
GCACCGGACACCGCGCGACGTGCGGTGCTCTTCCAGCCGTTAGACCCTACCTCCGACTGAGTCGTTTCTAGGGTGGGCAGGCTGTTAAACAGAAAAGATA
ACTCTTCCCGAGGCCCCCGCTGGCGTCTCCGGAATCCCTAACGTTGCCATCAGCCGCCACATCCCAGTTCAGGAATTTTAACCTGATTCCCTTTCGAAGC
TCGCGTGAAACACGCTATCTGACGGGCTTCCCCCGTCTCTTAGGATCGACTAACCCATGTGCAAGTGCCATTAACATGGAACCTTTCCCCTCTCCGGCCT
TCAAAGTTCTCATTTGAATATTTGCTACTACCACCAAGATCCGCACCGACGGCCGCTCCGCCCGGGCTCACGCCCAAGGTTTTGCTCCGCCCG