Detailed information on CNT3021476


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3021476

Peptides detected in this lncRNA

>peptide 1 (53 aa)
CISKYKGVSELGVEYPNRKGWWSVWREGRLLGEIESKRIKFVSWFVGFCLHKR*

Sequence

>CNT3021476
TGTATAAGTAAGTATAAAGGGGTTAGTGAGTTGGGTGTGGAATATCCAAATAGAAAAGGATGGTGGAGTGTTTGGAGAGAAGGGAGGTTGCTTGGTGAAA
TTGAAAGCAAAAGGATCAAATTTGTTTCTTGGTTTGTGGGTTTCTGCCTCCACAAGAGATAGAGGTGAACATGCTCTTGTGCTGAGGTTTTATTTTCAAG
TTTATCTACCTGGCTGCTCCTTGTTCAAGGGACATGGCTTTGATACTAATTGTTGTATGAGAACCATCCACGAAACTTACAAAATTTGGTGTTTGAGATA
CTTGTCCTCCGCGTATCTCCATAATTAGTATTATCTACTTTAGTTATAAGTTTTGTGACCTTGCTTACGGAATCACCCTAGAATGTTTCATACTAATGGT
CTTTATTGCTCCTCACTTATATATCTATAATCTTGTCAATATGGGA