Detailed information on CNT30214147


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CH33|UBQ11_ARATH, E-value = 2e-159

BLAST vs NONCODE:
NONMEST001181, E-value = 4e-125

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30701196Helianthus annuusQuercus lobata84.9577.782.58683forward
CNT30406246Helianthus annuusBeta vulgaris82.5998.9683.13664forward
CNT30488054Helianthus annuusOlea europaea80.8575.6783.08650forward
CNT3045767Helianthus annuusPrunus dulcis84.9546.5385.51683forward
CNT3096867Helianthus annuusSolanum tuberosum80.8574.4683.85650forward
CNT30540607Helianthus annuusBrassica napus84.9546.2783.46683forward
CNT30233494Helianthus annuusBrassica oleracea64.871.6686.56521forward
CNT3061706Helianthus annuusArabidopsis lyrata80.8570.9683.85650forward
CNT3073437Helianthus annuusBrassica juncea85.9575.0384.23691forward
CNT30260853Helianthus annuusBrassica rapa84.9576.0683.89683forward
CNT30613113Helianthus annuusArabis alpina84.9574.3283.31683forward
CNT30359535Helianthus annuusLactuca sativa84.5840.2685.44680forward
CNT30410857Helianthus annuusPapaver somniferum85.752.7683.02689forward
CNT3026451Helianthus annuusPopulus trichocarpa84.5873.9184.26680forward
CNT30120507Helianthus annuusCitrus clementina82.7161.1283.31665forward
CNT30334097Helianthus annuusCynara cardunculus84.761.9784.14681forward

Expression of CNT30214147

Peptides detected in this lncRNA

>peptide 1 (44 aa)
MPSLSWILALTLSMVSELSTSKVIVFPVKVLTKICIPPLSLSTR*

>peptide 2 (48 aa)
MEGGFLLDVVVSKSTTILKLFSSKDQSLLVWWDALFILDLSLDIINGV*

Sequence

>CNT30214147
TTATAAAACCATGATTTTTATTTGAAATTGCACCATTGTCAACCACCACATATAATTGTAACACAGAAACCTTTCAAAGAAACACAAACATAACAAAAGC
TATAAGCTTTTAGTTACCCCCACGGAGACGAAGGACAAGGTGGAGGGTGGACTCTTTCTGAATGTTGTAGTCCGCAAGCGTGCGTCCATCCTCAAGCTGC
TTACCCGCAAAGATCAGCCTCTGCTGGTCCGGTGGGATGCCTTCCTTGTCCTGAATCTTCGCCTTCACGTTGTCAATCGTATCAGAGCTCTCCACCTCAA
GCGTTATAGTCTTGCCAGTCAAAGTCTTCACAAAAATCTGCATACCACCACGAAGACGAAGCACCAAATGGAGGGTGGATTCCTTCTGGATGTTGTAGTC
AGCAAGAGTACGACCATCCTCAAGCTGTTTTCCAGCAAAGATCAATCTCTGTTGGTCTGGTGGGATGCCCTCTTTATCTTGGATCTTAGCCTTGACATTA
TCAATGGTGTCTGAGCTTTCAACTTCCAAAGTGATTGTCTTTCCGGTTAAAGTCTTAACAAAGATCTGCATCCCACCCCTCAGCCTGAGCACAAGATGAA
GGGTTGACTCCTTTTGGATGTTGTAGTCGGCTAAGGTACGGCCGTCTTCAAGCTGCTTTCCGGCAAAGATCAATCTTTGCTGGTCTGGAGGGATCCCCTC
CTTGTCTTGGATCTTGGCCTTAACATTGTCAATTGTATCAGAACTCTCGACCTCGAGAGTGATGGTCTTTCCGGTTAAAGTTTTCACAAAGATCTGCATC
TGGA