Detailed information on CNT3021339


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONSLYT000794, E-value = 7e-43

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30523536Citrullus lanatusSetaria italica41.1746.1980.46261forward
CNT30640872Citrullus lanatusNymphaea colorata71.2959.7182.52452forward
CNT30536082Citrullus lanatusEucalyptus grandis85.1791.2279.63540forward
CNT30316118Citrullus lanatusCorylus avellana66.8859.3882.78424forward
CNT30516792Citrullus lanatusJuglans regia9769.182.11615forward
CNT30700805Citrullus lanatusQuercus lobata38.881.1982.93246forward
CNT30377104Citrullus lanatusArabidopsis thaliana73.6666.1582.66467forward
CNT30500604Citrullus lanatusCoffea canephora80.683.0980.04511forward
CNT30616482Citrullus lanatusSesamum indicum87.736.4678.24556forward
CNT30269286Citrullus lanatusChenopodium quinoa81.0778.2381.13514forward
CNT30727661Citrullus lanatusCorchorus capsularis82.9784.0381.75526forward
CNT30378927Citrullus lanatusManihot esculenta92.7494.9978.74588forward
CNT30524942Citrullus lanatusPhaseolus vulgaris61.8358.4282.65392forward
CNT30628927Citrullus lanatusVigna unguiculata66.5675.3679.86422forward
CNT30195835Citrullus lanatusPisum sativum34.3885.8381.19218forward
CNT30489068Citrullus lanatusOlea europaea43.2255.4785.4274forward
CNT30506120Citrullus lanatusNicotiana attenuata31.0733.6882.23197forward
CNT30708216Citrullus lanatusGlycine max70.8280.3280.62449forward
CNT3042435Citrullus lanatusPrunus dulcis84.8677.7581.41538forward
CNT30304911Citrullus lanatusTriticum aestivum42.4344.9880.3269forward
CNT30400472Citrullus lanatusTriticum turgidum37.8524.0780.83240forward
CNT30559890Citrullus lanatusActinidia chinensis55.6851.6883353forward
CNT30591924Citrullus lanatusMusa acuminata54.2664.5480.23344forward
CNT3088022Citrullus lanatusVigna radiata23.9735.1985.53152forward
CNT30234460Citrullus lanatusBrassica oleracea67.0360.4683.53425forward
CNT30508904Citrullus lanatusSolanum lycopersicum63.7265.3779.7404forward
CNT30554721Citrullus lanatusOryza glaberrima60.8841.2879.27386forward
CNT30145737Citrullus lanatusMedicago truncatula45.2746.5980.84287forward
CNT30442780Citrullus lanatusAegilops tauschii59.1547.2979.47375forward
CNT30311656Citrullus lanatusCamelina sativa55.8463.7881.36354forward
CNT3062262Citrullus lanatusArabidopsis lyrata62.7872.6381.41398forward
CNT3076593Citrullus lanatusBrassica juncea74.1386.0883.62470forward
CNT30263540Citrullus lanatusBrassica rapa63.7262.6484.65404forward
CNT30468540Citrullus lanatusSaccharum spontaneum63.7246.6579.21404forward
CNT30141877Citrullus lanatusLolium perenne51.8973.4479.03329forward
CNT30605857Citrullus lanatusGossypium raimondii95.974.9780.43608forward
CNT3067979Citrullus lanatusLeersia perrieri53.3193.8981.07338forward
CNT30648676Citrullus lanatusRosa chinensis74.9263.7681.89475forward
CNT30205103Citrullus lanatusHelianthus annuus22.0819.7785140forward
CNT30713436Citrullus lanatusMalus domestica golden26.3451.8683.83167forward
CNT30625277Citrullus lanatusDaucus carota47.1648.781.27299forward
CNT30687691Citrullus lanatusTriticum urartu43.3830.880.73275forward
CNT30350932Citrullus lanatusEragrostis tef58.528380.32371forward
CNT30476941Citrullus lanatusArabidopsis halleri73.6658.382.01467forward
CNT30366857Citrullus lanatusSorghum bicolor68.9344.578.95437forward
CNT30620243Citrullus lanatusCajanus cajan34.2365.3682.95217forward
CNT30596736Citrullus lanatusOryza meridionalis36.7530.8681.55233forward
CNT30354603Citrullus lanatusLactuca sativa53.3149.9381.36338forward
CNT30370935Citrullus lanatusOryza glumipatula40.0626.2480.71254forward
CNT30154742Citrullus lanatusPrunus persica84.8664.1281.6538forward
CNT30408809Citrullus lanatusPapaver somniferum89.1265.3981.24565forward
CNT30573855Citrullus lanatusVitis vinifera86.1290.780.95546forward
CNT30705859Citrullus lanatusPrunus avium69.7259.1782.58442forward
CNT30642027Citrullus lanatusCannabis sativa61.6761.2981.84391forward
CNT3051605Citrullus lanatusAmborella trichopoda82.1878.5880.23521forward
CNT3023412Citrullus lanatusPopulus trichocarpa48.1153.9881.64305forward
CNT30121049Citrullus lanatusCitrus clementina97.7957.380.32620forward
CNT3035176Citrullus lanatusCucumis melo84.0796.9190.43533forward
CNT30149986Citrullus lanatusBrachypodium distachyon60.0942.4779.27381forward
CNT30103004Citrullus lanatusOryza rufipogon51.4232.780.67326forward
CNT30584421Citrullus lanatusEchinochloa crusgalli67.9853.4780.74431forward
CNT30497905Citrullus lanatusDigitaria exilis55.6839.0979.89353forward
CNT30176441Citrullus lanatusVigna angularis31.0732.5682.74197forward
CNT30558075Citrullus lanatusPanicum hallii46.6937.5282.77296forward
CNT30114394Citrullus lanatusFicus carica38.6441.1880.41245forward
CNT3049544Citrullus lanatusCucumis sativus106.6284.3987.87676forward

Expression of CNT3021339

Peptides detected in this lncRNA

>peptide 1 (68 aa)
MLGCRKETWDYKKVMLGCRRVKLGCRRVKLGCRQGKWDCKQGKWDCKQVRWGCSLGKWGCSLVMWGYN*

Sequence

>CNT3021339
GAAGGAGACAACCGTGGACTACTGGGTGAGTATGCCTGTGATGGGCTGTATTTAGCTGATTGAGGATTATAACTAGGTGATGTGGGACTATAGCTAGGAG
AAGTGGGGCTATAGCTCGGTGATGTGGGACTATAGCCAGGGGAGGTGGGGCTATATGCTGGAGAGGTGGGGCTGTACGAGGGTGATGTAGGACTGTAAGA
GGGAGATGTTGGGCTGTAGGAAGGAGACGTGGGACTATAAGAAGGTGATGTTGGGCTGTAGGAGGGTGAAGTTGGGCTGTAGGAGGGTGAAGTTGGGCTG
TAGGCAGGGGAAGTGGGACTGTAAGCAGGGGAAGTGGGACTGTAAGCAGGTGAGGTGGGGCTGTAGCTTGGGGAAGTGGGGCTGTAGCTTGGTGATGTGG
GGCTATAACTAGGAGAGGTGGGGCTGTAACTGGGAGAGGTGGGCGAATAAGATGGACTCGTAGGAGAATATGCAGGACTAGTTGGGCTATAACCAGGCGA
ACTAGGACTGTAAGTCGGAGATGTTGGACTGTAGCCAGGAGAGGTAGGGCTGTATCCTGGAGAAGTAGGACTATAACCAGGAGATGTGGGACTATAGCCA
GGGGATGATGGACTGTAGCCTGGAGATGATGGGC