Detailed information on CNT30212612


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30675423Helianthus annuusSetaria viridis62.2444.6482150forward
CNT30549907Helianthus annuusIpomoea triloba64.3228.8685.81155forward
CNT30515028Helianthus annuusJuglans regia54.3615.4381.68131forward
CNT30374815Helianthus annuusArabidopsis thaliana66.3938.7488.12160forward
CNT30266655Helianthus annuusChenopodium quinoa89.2119.1384.19215forward
CNT30402638Helianthus annuusBeta vulgaris55.610.4687.31134forward
CNT30628634Helianthus annuusVigna unguiculata51.8717.3684.8125forward
CNT30194995Helianthus annuusPisum sativum65.5616.681.65158forward
CNT30495282Helianthus annuusOlea europaea82.9911.3682.5200forward
CNT30712013Helianthus annuusGlycine max64.3234.6885.81155forward
CNT3047443Helianthus annuusPrunus dulcis54.3610.9883.21131forward
CNT30158121Helianthus annuusPistacia vera66.3925.688.12160forward
CNT3090332Helianthus annuusSolanum tuberosum89.2133.0882.33215forward
CNT30181754Helianthus annuusSecale cereale83.431.9679.1201forward
CNT30294498Helianthus annuusTriticum aestivum82.9925.0381200forward
CNT30561874Helianthus annuusActinidia chinensis27.397.4892.4266forward
CNT3086110Helianthus annuusVigna radiata30.716.6287.8474forward
CNT30174161Helianthus annuusTrifolium pratense88.827.1283.64214forward
CNT30144140Helianthus annuusMedicago truncatula64.3241.5585.81155forward
CNT30662024Helianthus annuusTriticum dicoccoides45.6421.6583.64110forward
CNT3082721Helianthus annuusBrassica juncea29.8824.9187.572forward
CNT30606743Helianthus annuusGossypium raimondii63.0714.2383.55152forward
CNT30218668Helianthus annuusKalanchoe fedtschenkoi39.8324.8187.596forward
CNT30650282Helianthus annuusRosa chinensis92.5318.9382.96223forward
CNT30624603Helianthus annuusDaucus carota59.7521.8286.11144forward
CNT30686069Helianthus annuusTriticum urartu42.3211.9986.27102forward
CNT30620812Helianthus annuusCajanus cajan51.8710.0682.4125forward
CNT30597062Helianthus annuusOryza meridionalis72.6115.9183.43175forward
CNT30355133Helianthus annuusLactuca sativa75.120.6982.32181forward
CNT30420528Helianthus annuusPapaver somniferum97.9312.3885.59236forward
CNT30571189Helianthus annuusVitis vinifera87.1434.0986.67210forward
CNT3055164Helianthus annuusAmborella trichopoda25.315.393.4461forward
CNT3024331Helianthus annuusPopulus trichocarpa91.721.1984.16221forward
CNT3035650Helianthus annuusCucumis melo92.5316.5482.51223forward
CNT30101810Helianthus annuusOryza rufipogon65.156.1982.8157forward
CNT30116702Helianthus annuusOryza nivara41.089.6482.8399forward
CNT30174546Helianthus annuusVigna angularis60.5819.0884.25146forward

Expression of CNT30212612

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MSGLCCSMLTKTLQLSASRPTSADVNPISLQVSRTIFS*

>peptide 2 (79 aa)
SHLGLTISSITEHVTLVTSTDFLWLLGEMSVNTLGNVRALLLDVDQDLAVVGIKTNISRCKSNFSASVTDNLLVVYISLG

Sequence

>CNT30212612
CAGTCACTTGGGTCTTACCATCAGTAGCATAACCGAACATGTGACCTTGGTCACCAGCACCGATTTCCTCTGGCTTCTTGGTGAGATGTCCGTGAACACC
CTGGGCAATGTCAGGGCTCTGTTGCTCGATGTTGACCAAGACCTTGCAGTTGTCGGCATCAAGACCAACATCAGCAGATGTAAATCCAATTTCTCTGCAA
GTGTCACGGACAATCTTCTCGTAGTCTACATTAGCCTTGGT