Detailed information on CNT3021193


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Expression of CNT3021193

Peptides detected in this lncRNA

>peptide 1 (83 aa)
MPLYSLNYINAICWGRSHPYLTSFCYFSILENHTPQPTIEVREPSYLSTMLVIPFLLICPKSNSYRCETYVTHTILVANSFFY*

>peptide 2 (54 aa)
MEEDALVSLEEELHIAMAYILVWRRAIVLLVLVSKFKLCSFVLFAIIFIHHTTI*

Sequence

>CNT3021193
CGATTTCATGAAACAGCTTGGATTCTACTATTCCACTAAGCCGTTGGATCTAACTTCTGATTAGGGTTCGGCGAGAGGTTCCCCTGCAATGCCCTAATTT
AGACCATCCCTGTATTTAAATGGCAATGCCAAAGTTCCATTAGCGCCGTCCTACAATCCAGTGGCGGAAGCGTTAAGCGTTTGTGCTTAAATACTAGAAT
CAAGGTTTGCAGCTCATGGGGTCTTAAGCCATTATTTCTTGCTTTAATCCAAGGGCTGTCAAGTGTTCCTGATGCTTATTGTGGGTCATAGTGTACTTTT
GGAAAGGAAAGTTTATACCCAATTCTTCTTATTTAAACACTATATCATATAGAGAGTGATTGCCACAAATTTGATATCTCCCGACTAAACATTAATAACG
GTCTTTTGAAAGTTAGTAGCCTTTTAAGTTGTTCTGTTTTAATATTCAATGTGCAAATGGCTGGTTATGTTATGGTAATATTTTTATAGACAGAAGTTTG
TCAATAATTTTGCACGAGTACTGTGGTAATATTTTTATGGTAATGTTATTGAATGTCCAGAGTCTAGTATAATCGTGCACATATAGAAGATGGTATCCGC
CTTGCAGCTCAAACAATAGCATATTTCTGCTGCCTGTAATGCCACTATACTCTCTAAATTATATTAATGCCATTTGTTGGGGAAGATCTCACCCATATTT
AACAAGTTTCTGTTACTTCAGCATCTTGGAGAACCACACCCCACAGCCAACTATTGAGGTGAGAGAGCCAAGCTACTTAAGTACCATGTTGGTCATTCCA
TTCTTATTGATTTGTCCCAAATCTAACTCTTACCGATGTGAGACATATGTAACCCATACTATCTTGGTTGCTAATAGTTTCTTCTATTAGGAGGCAGAGT
AGTTTATGGGAGGAAATTTGACCAGAACACCTAGTATTTTAGTTTGAAGGCGTCAAAAGTTTACATGTAGGGATTGGTATAATGGTTAATTTTCTCTAAT
GGGAACTCATGCTAAAGTTGTACTTTGCTTTGTTGGTTTCTTTTATGATTAATTAAGAGTGACAGGAAAGCTGAACCACAACTAAAAGAACTTATCATTG
TTGTTGAATATTCTGTTTTTCCCTCTAGTGCCAAAGATTTCAAAAGAAAGATTTCTGAAAGGATGACTTTTGCCATTAGGTTGATGACCATTGAAAGGGC
CACATGTTAGAGGGTTCCAGCATTAAGAATGGCTGAGGGATAGATGACCATATGACTGTCACCATCTTGGGATAAAGGACACATGGAGGAGGATGCCTTA
GTTTCATTAGAGGAAGAACTTCACATTGCCATGGCATATATCCTTGTGTGGAGGAGGGCTATTGTCCTATTGGTCTTGGTCTCTAAGTTCAAATTATGTT
CTTTCGTACTATTTGCCATTATTTTTATACACCATACTACAATCTGAAGTTGCCTTTTCATTCTGTTTGTTAAACTGTCAGTAGCTTAGGCTATTTTCTA
ATAGTCGGCAAGCAATGGGGGATGAACTCTAAAACTTTTGTTGACAATTCTTTTTCACGGTTCATTGATATTTATATAATCTAATGATATAACATGAATT
GGATTGATGTATAGTATTCATGTTAAATCAAAATGAGCTTAACTAAA