Detailed information on CNT30211766


BLAST search results

BLAST vs Swiss-Prot:
sp|O23755|EF2_BETVU, E-value = 5e-33

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3054398Helianthus annuusAmborella trichopoda67.2323.0383.54158forward

Expression of CNT30211766

Peptides detected in this lncRNA

>peptide 1 (59 aa)
WTQTPSIQSTTTNAPSVIRSAAVTSDEKSTCPGESMRLMRYSFPLRSPLKLLRASSVIS*

Sequence

>CNT30211766
CTGGACGCAGACACCTTCGATACAATCAACAACCACCAATGCACCGTCAGTGATACGGAGTGCAGCAGTAACTTCGGATGAGAAGTCAACGTGCCCGGGT
GAATCAATGAGATTGATGAGGTACTCATTCCCATTACGTTCTCCTTTAAAGCTCTTGAGAGCCTCATCAGTCATTTCATAGTAAATGATATCCCAGTTGA
CTTGATCGTGATACCGCGTTCAGCTTCATCAGCAC