Detailed information on CNT30210603


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONMTRT001650, E-value = 5e-82

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30210603

Peptides detected in this lncRNA

>peptide 1 (58 aa)
MIGRADIEGSKSNVAMNAFLPQASYPCGNFSDTSSFNRMSPVLLFIVTTSPCQDWVICA

Sequence

>CNT30210603
CGACACTTTCATCAGTAGGGTAAAACTAACCTGTCTCACGACGGTCTAAATCCAGCTCACGTTCCCTATTGGTGGGTGAACAATCCAACACTTGGTGAAT
TCTGCTTCACAATGATAGGAAGAGCCGACATCGAAGGGTCAAAAAGCAATGTCGCTATGAACGCTTTTCTGCCACAAGCCAGTTATCCCTGTGGTAACTT
TTCTGACACCTCTAGCTTCAATCGTATGAGCCCGGTATTGTTATTTATTGTCACTACCTCCCCGTGTCAGGATTGGGTAATTTGCGCG