Detailed information on CNT3021040


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3021040

Peptides detected in this lncRNA

>peptide 1 (59 aa)
MGKVINGVCGQVRDRIRDGGGCFLNRSCSSQRKEANKIRKKHHKFQLLDFFWQTQGGEF*

>peptide 2 (32 aa)
MAFVVKFVIEYEMVAGVFLIEVVVAKEKKQTR*

>peptide 3 (48 aa)
MRIRTGVFVRNNIWPGVLSENPILCFVCELNMGIAMDSSGIVGTITRS*

Sequence

>CNT3021040
TAATGAGTAAGGAAAACAAAGTGGTCGGGGGGATCCGGCCGCAGCGCTTACCATTGTTATGCGCATGAATTTGTGGAGGGGTTAAAGGCTGGCCGATTGT
TGACGCTGCTTACTTTGCAGAACTCTTTCGTGCTGGCCTCCCAATTTACCCACCCCCAATTTCAGTTCTAAACTTCCCTATTATTATTCCCAACCCCAAT
TTGAATATTCGTTTGAGAAACTTCCTTCGATATTTGTAGGAACGTTGCACGGATTTTATCGAAGAACCTAATTAGAGTTTCAGAAATGTGAATCGAACGG
GATTTGTTAGGACATTTATACGGATTTAATCGGGAGAACACTAATTTGAGTTTTCATTTGTTTCCAATGCGCATTCGAACCGGGGTTTTTGTAAGGAACA
ATATTTGGCCGGGGGTATTATCTGAAAACCCTATTTTATGTTTCGTTTGTGAATTGAATATGGGAATTGCAATGGATTCGTCGGGAATCGTAGGAACAAT
TACCAGATCATAACCATGCCTTAATTTCATTCTTCATGGGGAAAGTTATCAATGGCGTTTGTGGTCAAGTTCGTGATCGAATACGAGATGGTGGCGGGTG
TTTTCTTAATAGAAGTTGTAGTAGCCAAAGAAAAGAAGCAAACAAGATAAGAAAAAAGCACCACAAGTTTCAGCTACTTGATTTTTTTTGGCAAACACAA
GGAGGAGAGTTTTAAAGAAAAATCTGAAGACCATTTCTTCATCAGCCAAATAAATATGGTCCAAGTCTGCTAACAACTGATTTATCGAAGACCGTGCATC
GAAGAGGAGTAAACTAAGTTATGAAGCTCTACATACTTATGTACCAGTAAGCTCAATTATGAAGCTCTGCATACTTTCGTAGGAGTAAACACAGTTACGA
GGCTCTGCATAATCCACCCAAAAGGTTATAATTTCCATATTCATCTTAACCATTATGGTGTGCGTATGCTATAGCATATAATTTTTTTATAACCACAAAG
AGACAAATGTAATATATAATTATTATATCAAAATTCTAAAAATTGATGGGACCTAAAAATAAATGAATTTAACCTATGAGTTTGATGGCTTGATATCATT
TTTACCTTCATTTTGTTTGCCATAGATAGTTTGTGGAAGGGGTTCTAAATTTAACTCATGTTGAGATGATGGTGAAAATTTTGTGAAATTTAAACAAAAA
ACTTAGGACATTGTGAGATTTAAACCAAAAACTTAG