Detailed information on CNT3020922


BLAST search results

BLAST vs Swiss-Prot:
sp|P48352|CATA3_CUCPE, E-value = 1e-135

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3020922

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MTVEKRTMTGVWTPGARRKSAQVAIFSMS*

>peptide 2 (44 aa)
MVRAEIQESPWLLEVGFWVGFEGTDDVGELHCVTYEEYGEVVAH*

>peptide 3 (62 aa)
SIHWELKIVRSKAMPLCIRISKTPSLQHLIIRVMNPSMLFTPQVGFQWNLTSRAFPALLIRE*

Sequence

>CNT3020922
GGAGCATTCACTGGGAGCTGAAGATAGTTAGGTCCAAGGCGATGCCTCTGTGTATCCGCATAAGCAAAACTCCTAGCTTGCAACATCTTATCATCCGAGT
AATGAATCCCAGCATGCTTTTCACACCGCAAGTGGGTTTCCAATGGAATTTGACAAGCCGGGCTTTCCCAGCTTTGTTGATTAGAGAGTAGGCTTGGACG
CCGAAGCCTTCCATGTGGCGGTAGTTGATTGGGATGCCCACGTCATCGTAGAACCAAGCGAAAGACAGAAGGCTTTCCGGATGGTAAGAGCAGAAATCCA
GGAATCTCCATGGCTCTTGGAGGTGGGATTTTGGGTTGGGTTTGAAGGCACGGATGACGTCGGGGAATTGCATTGCGTCACGTACGAAGAATACGGGGAA
GTTGTTGCCCACTAAGTCGAAGTTGCCTTCACGTGTGTAGAATTTGACGGCGAATCCACGGGGGTCACGGAGGGTTTCGGGGCTGCCGCGCTCGTGGATG
ACGGTGGAGAAACGGACGATGACGGGGGTTTGGACGCCGGGGGCACGGAGGAAGTCGGCGCAGGTCGCGATTTTTTCGATGAGTTGATAGTCTTCTAACA
GGATTGGGCCTCGTTCTCCGACGGACATCACGGCGGTGTTGTTCCATACTGGTGCGCCGGAGTTTGTCGTGCAGAATGGGGTGTTGTA