Detailed information on CNT3020877


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONTAET000303, E-value = 3e-53

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3020877

Peptides detected in this lncRNA

>peptide 1 (57 aa)
KRILPTARWELCFKAAPATHPSQGLSQRHVPLGAGRPLCWSAIERWAHASLLARILT*

Sequence

>CNT3020877
TGAAAAGGATTCTACCCACCGCTCGGTGGGAATTATGTTTCAAGGCGGCCCCCGCAACTCATCCGTCACAAGGGCTTAGCCAACGACACGTGCCTTTGGG
GGCCGGAAGGCCCCTCTGTTGGTCGGCAATCGAGCGATGGGCGCATGCGTCGCTTCTAGCCCGGATTCTGACTTAGAGGCGTTCAGTCATATGTGAAACT
GCGAATGGCTCATTAAATCAGTTATAGTTTGTTTGATGGTATCTGCTACTTGGATAACCGTAGTAATTCTAGAGCTAATACGTGCAACAAACCCTGACTT
CTGGAAGGGATGCATTTATTAGATAAAAGGTCGACGCGGGCTCTGCCCGTTGCTTTGATGATTCATGATAACTCAACGGATTGCACG