Detailed information on CNT3020809


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3039115Citrullus lanatusCucumis melo69.0821.9387.36277forward

Expression of CNT3020809

Peptides detected in this lncRNA

>peptide 1 (49 aa)
MSCHLASRLTILFIFFYLLMHQFYVRRKKHKMMRFFLLLVLLRVNLTAI*

>peptide 2 (41 aa)
HHQRDLLFSYNIAIDRTEEMKRILGKSAASVGLQLPEAYQP*

Sequence

>CNT3020809
CATCATCAAAGGGATTTGCTGTTCTCGTACAACATTGCTATTGATAGAACAGAGGAAATGAAGCGAATATTGGGCAAGTCTGCAGCAAGTGTGGGACTTC
AACTTCCCGAGGCTTATCAACCATGATGCCCTGTGGTTGTTTTATTAAGAAGCACTTTTTTCCCCCAAGCAAAGAAGAATAAGCACTTCCATGAGCTGCC
ACCTTGCCAGCAGACTTACAATACTGTTCATCTTTTTCTACCTTCTGATGCATCAATTTTATGTGCGTCGAAAGAAACATAAGATGATGAGATTTTTCCT
CTTATTAGTACTTCTGAGGGTGAATTTGACAGCAATCTAATGTGATGTTTGTTTCACTTCCAATTAAATATAAAATTTAATAATGTGAAAAAGAGCTGAT
G