Detailed information on CNT30206324


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT001029, E-value = 2e-66

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30206324

Peptides detected in this lncRNA

>peptide 1 (36 aa)
ERRRAESQWIVAARPLCHLQYPVTYLSHLQRILPVA*

>peptide 2 (38 aa)
MCRPSQIPHLTMSSARIDPPRRALGPKKRALPRFRFTE*

Sequence

>CNT30206324
CTGAGCGACGCAGGGCTGAATCTCAGTGGATCGTGGCAGCAAGGCCACTCTGCCACTTACAATACCCCGTCACGTATTTAAGTCATTTGCAAAGGATTCT
ACCCGTCGCTTGATGGGAATTGTACTTCAAGGCGGCCCGCGCGGCTCGTCTGCCACGCGAGCTTAGCCTACGACACGTGCCTTTGGGGGCCGAGGCCCCT
ACTGCTGGTCGGCAAACAGGCGACGGGCACACGCGTCGCTTCTCATCTTAGGACACCTGCGTTATCTTTTAACAGATGTGCCGCCCCAGCCAAATTCCCC
ACCTGACAATGTCTTCCGCCCGGATCGACCCGCCGAGGCGGGCCTTGGGTCCAAAAAAAAGGGCGTTGCCCCGCTTCCGATTCACGGAATAAGTAAAATA
ACG