Detailed information on CNT30205386


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONSLYT000794, E-value = 8e-34

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30523536Helianthus annuusSetaria italica54.8369.3879.59392forward
CNT30315993Helianthus annuusCorylus avellana31.3322.3382.59224forward
CNT30377104Helianthus annuusArabidopsis thaliana32.7333.1482.48234forward
CNT30616399Helianthus annuusSesamum indicum43.543.4481.99311forward
CNT30628902Helianthus annuusVigna unguiculata32.5952.681.55233forward
CNT3091613Helianthus annuusSolanum tuberosum54.1351.1980.62387forward
CNT30304911Helianthus annuusTriticum aestivum43.9252.5180.25314forward
CNT30400472Helianthus annuusTriticum turgidum46.013381.16329forward
CNT30559890Helianthus annuusActinidia chinensis49.5151.8380.23354forward
CNT30591858Helianthus annuusMusa acuminata46.5765.6880.18333forward
CNT3088002Helianthus annuusVigna radiata35.147.3681.27251forward
CNT30508904Helianthus annuusSolanum lycopersicum43.0849.8481.82308forward
CNT30554580Helianthus annuusOryza glaberrima40.1442.2180.14287forward
CNT30145737Helianthus annuusMedicago truncatula54.9763.878.63393forward
CNT30443444Helianthus annuusAegilops tauschii45.8735.2380.79328forward
CNT30256655Helianthus annuusAvena sativa42.2467.2682.78302forward
CNT30311681Helianthus annuusCamelina sativa35.9435.7982.1257forward
CNT3062262Helianthus annuusArabidopsis lyrata48.1162.7779.94344forward
CNT30468540Helianthus annuusSaccharum spontaneum41.8234.5381.61299forward
CNT30141877Helianthus annuusLolium perenne41.466.0781.08296forward
CNT3016767Helianthus annuusZea mays46.0143.5282.67329forward
CNT30608057Helianthus annuusGossypium raimondii36.7844.3582.89263forward
CNT30216750Helianthus annuusKalanchoe fedtschenkoi45.5966.5380.98326forward
CNT3067990Helianthus annuusLeersia perrieri35.2466.1481.35252forward
CNT30625547Helianthus annuusDaucus carota43.2229.7781.55309forward
CNT30341751Helianthus annuusEragrostis tef36.7854.3482.51263forward
CNT30366857Helianthus annuusSorghum bicolor46.0133.582.07329forward
CNT30596736Helianthus annuusOryza meridionalis40.1438.0180.49287forward
CNT30370935Helianthus annuusOryza glumipatula40.1429.6580.14287forward
CNT30154934Helianthus annuusPrunus persica50.2177.7181.34359forward
CNT30408809Helianthus annuusPapaver somniferum49.9341.3281.23357forward
CNT30573841Helianthus annuusVitis vinifera47.5571.7381.76340forward
CNT30642025Helianthus annuusCannabis sativa40.5656.5383.1290forward
CNT3027914Helianthus annuusTheobroma cacao37.6289.9782.53269forward
CNT3051546Helianthus annuusAmborella trichopoda44.3465.7780.44317forward
CNT30109704Helianthus annuusOryza longistaminata33.0142.4582.2236forward
CNT3035176Helianthus annuusCucumis melo55.2471.8279.49395forward
CNT30149777Helianthus annuusBrachypodium distachyon45.5935.483.74326forward
CNT30103004Helianthus annuusOryza rufipogon36.3626.0881.15260forward
CNT30584594Helianthus annuusEchinochloa crusgalli38.4644.582.18275forward
CNT30497833Helianthus annuusDigitaria exilis37.7630.6181.48270forward
CNT30176441Helianthus annuusVigna angularis41.448.9380.07296forward
CNT30551544Helianthus annuusOryza brachyantha32.5933.5384.12233forward
CNT30114394Helianthus annuusFicus carica24.229.0883.82173forward
CNT3049385Helianthus annuusCucumis sativus35.2431.8281.35252forward

Expression of CNT30205386

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MVKWGCRMGRSGCTLGMSGCMLGMSGCRQET*

Sequence

>CNT30205386
CTGTAGCTAGGTGACGTCGGGCTATATGGACTTGAAGGTGACAGCCTCGGACTGCTAGGGGAATAAGCAAGAGAGGGGCTGTACTTGGCAGATGACGGAT
TGTAACTTGGTGAGGTTGGGCTGTAGCTTGGTGAAGTTGGGCTGTAGCTAGGCGAAGTTGGACTGTAGCCAGGAGAAGTCGGGCTGTAAGCAGGTGAGGT
GGGGCTGTAGGATGGAGAGGTAGGGCTGTAGGATGGAGAGGTGGGGCTGTATGATGGGGAGGTAGGGCTGTAGGATGGTGAAGTGGGGCTGTAGGATGGG
GAGGTCGGGCTGTACGCTGGGGATGTCGGGCTGTATGCTGGGGATGTCGGGCTGTAGGCAGGAGACGTAGGGCTGTAACTAGGTGATGTGGGGCTATAAC
TAGGTGACGTGGGTGAGTAACTGGGAGATGTGGGGGAGTAGCTAGGTGAGGTGGGAGAATAGCTGGGAGAAGTCGGGGAGTACGTAGGACTGGTTGGACT
ATAGCCAGGGGAACTTGGACTATACGTTGGTGATGTAGGGCTATAACCGGGTGATGTAGGGCTATAGCCAGGAGACGAAGGGCTGTAACCTGGAGAAGAG
GGACTGTATCCAGGTGAAGAAGCCGGAGAAAAGCCCATCCCGCCAACATAAGGTGAAAACTGTGCATCGTTAAACGGTGACAATCTTAGATTCGGGCTCA
GAAGATAATTAGTCG